Abstract
Responsible for the ongoing coronavirus disease 19 (COVID-19) pandemic, severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2) infects host cells through binding of the viral spike protein (SARS-2-S) to the cell-surface receptor angiotensin-converting enzyme 2 (ACE2). Here we show that the high-density lipoprotein (HDL) scavenger receptor B type 1 (SR-B1) facilitates ACE2-dependent entry of SARS-CoV-2. We find that the S1 subunit of SARS-2-S binds to cholesterol and possibly to HDL components to enhance viral uptake in vitro. SR-B1 expression facilitates SARS-CoV-2 entry into ACE2-expressing cells by augmenting virus attachment. Blockade of the cholesterol-binding site on SARS-2-S1 with a monoclonal antibody, or treatment of cultured cells with pharmacological SR-B1 antagonists, inhibits HDL-enhanced SARS-CoV-2 infection. We further show that SR-B1 is coexpressed with ACE2 in human pulmonary tissue and in several extrapulmonary tissues. Our findings reveal that SR-B1 acts as a host factor that promotes SARS-CoV-2 entry and may help explain viral tropism, identify a possible molecular connection between COVID-19 and lipoprotein metabolism, and highlight SR-B1 as a potential therapeutic target to interfere with SARS-CoV-2 infection.
Similar content being viewed by others
Main
Since the outbreak of COVID-19 caused by SARS-CoV-2, approximately 1 million people have died and the total number of global confirmed cases was over 30 million as of 28 September 20201. Coronavirus tropism is predominantly determined by the interaction between coronavirus spike (S) proteins and their corresponding host receptors2,3. The S protein of SARS-CoV-2 (SARS-2-S) can be cleaved into the S1 (SARS-2-S1) and S2 (SARS-2-S2) subunits, which are responsible for receptor recognition and membrane fusion4. Binding of SARS-CoV-2 to ACE2 occurs via the C-terminal domain (also called the receptor-binding domain (RBD)) of SARS-2-S1 (ref. 5). The observed incomplete inhibition mediated by ACE2 antibodies and the high neutralization potency of monoclonal antibodies (mAbs) targeting the N-terminal domain (NTD) of SARS-2-S1 suggest that SARS-CoV-2 might use other (co)receptors or other mechanisms for host cell entry6.
SR-B1 is a cell-surface HDL receptor that mediates the selective uptake of cholesteryl esters and other lipid components of receptor-bound HDL particles7. This cholesterol delivery system is well recognized in isolated hepatocytes, fibroblasts, adipocytes, macrophages, adrenal cells, ovarian cells and testicular Leydig cells8. Interestingly, alveolar type II cells also express SR-B1, where it is responsible for vitamin E uptake, preferentially from HDL9,10. SR-B1 has emerged as a critical receptor that affects HCV entry11; however, a potential role of SR-B1 in SARS-CoV-2 infection is unknown.
Results
The SARS-CoV-2 S protein binds to cholesterol
Due to the importance of SARS-2-S in mediating the infection of target cells, we conducted a search for cholesterol-regulated motifs in the primary sequence of SARS-2-S and identified six putative cholesterol recognition amino acid consensus (CRAC) motifs adjacent to the inverted cholesterol recognition motif known as CARC12 (Fig. 1a). We then evaluated the ability of SARS-2-S to associate with cholesterol. Microscale thermophoresis (MST) assay showed that SARS-2-S could bind to cholesterol (Fig. 1b), but did not bind campesterol or epicholesterol, two structurally distinct sterols with additional methyl and hydroxyl groups (Fig. 1c). In a competition assay, unlabelled SARS-2-S protein had a half-maximum inhibitory concentration (IC50) of 195.7 ± 49.1 nM for cholesterol (Extended Data Fig. 1a). We then evaluated the interaction of SARS-2-S, SARS-2-S1 and SARS-2-S2 with HDL particles. Whereas SARS-2-S and SARS-2-S1 bound to cholesterol (Fig. 1b) and interacted either with HDL or with its components (Fig. 1d), SARS-2-S2 failed to bind to cholesterol (Fig. 1b) or HDL (Fig. 1d and Extended Data Fig. 1b). Surface plasmon resonance (SPR) assay did not provide evidence for stable binding of SARS-2-S1 to HDL, but suggested transfer of some materials from HDL to SARS-2-S1 protein (Fig. 1e). Notably, SARS-2-S did not bind to ApoA1 protein (Extended Data Fig. 1c). Together, these results support the notion that the SARS-2-S1 has specific affinities for cholesterol and possibly HDL components. We then attempted to dissect the interacting determinants in SARS-2-S1 through an in vitro binding assay. Among the four cholesterol-binding peptides encompassing the CARC-CRAC region, three putative cholesterol recognition regions were observed to reside in the NTD of SARS-2-S1, while one motif was located in the RBD (SARS-2-RBD) (Fig. 1f). Consistent with this finding, SARS-2-RBD bound to cholesterol and HDL, or its components, in the MST assay (Extended Data Fig. 1d,e).
HDL enhances the entry of SARS-CoV-2 through SARS-2-S1 protein
We then sought to determine whether the association of SARS-2-S with HDL affects SARS-CoV-2 entry. To this end, the capacity of HDL to affect the entry of SARS-2-S-pseudovirus (SARS-CoV-2pp) was explored (Extended Data Fig. 2a). HDL enhanced SARS-CoV-2pp infection in a dose-dependent manner (Fig. 2a). In addition, HDL significantly increased authentic SARS-CoV-2 viral entry (Fig. 2b) and replication (Fig. 2c). To investigate the role of HDL in SARS-CoV-2 cell-surface attachment, cells were incubated with SARS-CoV-2 at 4 °C for 10 min and immunolabeled for SARS-2-S after washing. HDL induced a substantial increase in cell-surface SARS-CoV-2 attachment (Fig. 2d,e). Flow cytometry also revealed that HDL significantly increased cell-surface SARS-2-S binding (Fig. 2f,g and Extended Data Fig. 2b).
In a previous study, the mAb 1D2 was isolated from patients convalescing from COVID-19 and was shown to exhibit high neutralization potency against SARS-CoV-2 (ref. 6). Lys147, Lys150 and Tyr145, which are located in the cholesterol-binding motif of SARS-2-S, were identified as important antigenic sites for recognition by 1D2 (ref. 6). We thus examined the ability of this mAb to interfere with HDL binding to SARS-2-S1. Preincubation of 1D2 with SARS-2-S1 before the addition of HDL completely blocked the SARS-2-S1-HDL binding signal in the MST assay (Fig. 2h) and strongly reduced HDL-enhanced SARS-CoV-2 infection (Fig. 2i,j). Collectively, these data indicate that HDL enhances SARS-CoV-2 infectivity either by interacting with the NTD of SARS-2-S1 or through transfer of material from HDL to the SARS-2-S1 protein.
SR-B1 expression confers susceptibility to SARS-CoV-2 infection
As SR-B1 is a cell-surface receptor that binds HDL and plays a central role in HDL endocytosis and cholesterol efflux, we wondered whether the HDL-mediated enhancement of SARS-CoV-2 infectivity occurs through SR-B1. To test this possibility, SARS-CoV-2pp entry assays were performed using two SARS-CoV-2pp-permissive cell lines, Huh-7 and Vero E6. Huh-7 cells displayed higher surface (Extended Data Fig. 3a,b) and intracellular (Extended Data Fig. 3c) SR-B1 and ACE2 protein levels than Vero E6 cells. Notably, ectopic SR-B1 overexpression specifically enhanced Huh-7 susceptibility to SARS-CoV-2pp, but not to the unrelated VSV-Gpp (Fig. 3a and Extended Data Fig. 3d). In contrast, SR-B1 downregulation significantly reduced HDL-mediated enhancement of infection (Fig. 3b and Extended Data Fig. 3e). When using three short interfering RNAs (siRNAs) in different combinations to achieve variable potency against SR-B1 (Extended Data Fig. 3f), SARS-CoV-2pp infectivity was inversely correlated with the efficiency of silencing (Fig. 3c). We next sought to determine whether SR-B1 overexpression renders cells more susceptible to infection with authentic SARS-CoV-2. The RNA load of SARS-CoV-2 in Huh-7 cells transfected with siSR-B1 (Extended Data Fig. 3g) was approximately ten times lower than that observed in control cells (Fig. 3d), while SR-B1 overexpression (Extended Data Fig. 3h) in Vero E6 cells potently increased SARS-CoV-2 infection (Fig. 3e).
To further assess SARS-CoV-2pp susceptibility of cultured cells, MDCK, 293T and Hepa 1-6 cells with very low SARS-CoV-2pp susceptibility and nearly undetectable SR-B1 and ACE2 expression were evaluated (Extended Data Fig. 3a–c). We challenged these cells with SARS-CoV-2pp after transfecting them with complementary DNA vectors encoding human ACE2 and/or SR-B1 (Extended Data Fig. 4a–c). MDCK (Extended Data Fig. 4d) and 293T (Fig. 3f) cells became highly susceptible to SARS-CoV-2pp upon ACE2 expression, while Hepa 1-6 cells remained less permissive (Fig. 3g). Although SR-B1 introduction did not render these cells more permissive, the combined SR-B1 and ACE2 expression resulted in higher susceptibility than that observed with ACE2 or SR-B1 expression alone (Fig. 3f,g and Extended Data Fig. 4d). In particular, SARS-CoV-2pp infectivity was correlated with SR-B1 expression levels only when ACE2 was overexpressed (Fig. 3h and Extended Data Fig. 4e). Of note, the expression of SR-B1 with or without ACE2 did not modify the cell-surface expression levels of either of these entry factors at 24 h after transfection (Extended Data Fig. 4b,c). Given that SR-B1 only enhances viral uptake in the presence of ACE2, our results indicate that SR-B1 is an entry cofactor of SARS-CoV-2.
SR-B1 mediates SARS-CoV-2 attachment and entry
Further analysis was performed to assess the colocalization of SARS-CoV-2pp with SR-B1. Immunostaining results revealed colocalization of SR-B1 with SARS-CoV-2pp (Fig. 4a). In particular, depletion of SR-B1 significantly decreased authentic SARS-CoV-2 attachment (Fig. 4b and Extended Data Fig. 5a,b) and entry (Fig. 4c), while SARS-CoV-2 entry was greatly enhanced when SR-B1 was overexpressed (Fig. 4d and Extended Data Fig. 5a). Ectopic SR-B1 expression also led to significantly increased SARS-2-S cell-surface binding stimulated by HDL (Fig. 4e and Extended Data Fig. 5c,d). Because SARS-2-S cannot bind to SR-B1 directly (Extended Data Fig. 5e), we suggest that HDL might form a bridge between SARS-CoV-2 and SR-B1 during viral entry.
The involvement of SR-B1 was further validated by testing the effects of known pharmacological SR-B1 inhibitors, such as ITX 5061 (ref. 13) and block lipid transport-1 (BLT-1), on SARS-CoV-2 infection. ITX 5061 is a ketoamide that inhibits HDL catabolism through targeting SR-B1 (ref. 13). BLT-1 is a small molecule that inhibits the SR-B1-mediated selective transfer of lipids without affecting HDL–SR-B1 binding14. Both compounds exerted no unwanted cytotoxic effects (Extended Data Fig. 5f,g) and significantly blocked SARS-CoV-2pp infection (Extended Data Fig. 5h,i). Importantly, the HDL-mediated enhancement of SARS-CoV-2pp infectivity was blocked by BLT-1 and by clinical-grade ITX 5061 (Fig. 4f). To obtain direct evidence that ITX 5061 can indeed interfere with SARS-CoV-2 infection, we also infected Huh-7 cells with bona fide SARS-CoV-2 in the presence of HDL, with or without ITX 5061. ITX 5061 treatment strongly inhibited SARS-CoV-2 infection stimulated by HDL (Fig. 4g), demonstrating that SR-B1-mediated HDL uptake facilitates SARS-CoV-2 infection.
SARS-CoV-2 has been reported to attack multiple-organ systems and distribution analysis of SR-B1 in susceptible cells at the site of infection could shed new light on the tropism and potential transmission routes of the virus. Using immunohistochemistry, we found cell-surface SR-B1 staining in multiple regions of human lung tissue (Fig. 4h). Interestingly, coexpression of SR-B1 and ACE2 could also be seen in extrapulmonary tissues, including the colon, retina, small intestine and testis (Fig. 4h and Extended Data Fig. 6a,b). Overall, our data demonstrate that SR-B1 is coexpressed with ACE2 in multiple susceptible tissues and could potentially be involved during SARS-CoV-2 infection.
Discussion
With over 30 million people infected, COVID-19 represents a major public health problem of high socioeconomic impact. However, treatment options for COVID-19 are limited, and a vaccine for prevention against COVID-19 infection is currently not available. The results of our study demonstrate that SR-B1 facilitates SARS-CoV-2 cellular attachment, entry and infection. SARS-CoV-2 entry is inhibited by silencing SR-B1 expression and by SR-B1 antagonists. Moreover, SR-B1 expression levels have been shown to affect attachment, entry and replication of bona fide SARS-CoV-2 virus. Thus, as an entry cofactor, SR-B1 might represent a therapeutic target to limit SARS-CoV-2 infection.
HDL is an important lipoprotein present in human plasma that nonspecifically blocks or facilitates viral entry through SR-B1. In the present study, we observed that the presence of HDL significantly increases infection with SARS-CoV-2. Mechanistically, HDL facilitates viral attachment and entry, presumably by associating with SARS-2-S. An antibody blocking the putative cholesterol/HDL-binding site on SARS-2-S1 was observed to strongly inhibit HDL-enhanced SARS-CoV-2pp entry. The SPR data do not provide sufficient evidence to claim that a stable interaction occurs between HDL and SARS-2-S1 protein. Future studies will need to explore the molecular nature of the interaction between HDL and SARS-2-S1 protein and the potential transfer of material derived from HDL to SARS-2-S1.
SR-B1 cannot bind to the SARS-2-S protein directly. However, HDL-enhanced SARS-2-S attachment and SARS-CoV-2 entry were greatly increased by SR-B1 expression. Importantly, SR-B1 expression conferred the greatest cell susceptibility to SARS-CoV-2pp only when coexpressed with ACE2. Additional cell lines with varying degrees of SR-B1 and ACE2 receptor expression or primary targeted cells are needed to elucidate the molecular mechanism underlying how SR-B1 facilitates viral entry. Our present data support the notion that SR-B1 could function as a linker molecule that recruits viral particles to come into proximity with ACE2 by associating with HDL (Extended Data Fig. 7). An important step towards confirming such a model would be the identification of the SR-B1–ACE2 membrane complex that is important for viral entry.
If SR-B1 acts as a cofactor defining SARS-CoV-2 attachment to target cells, an important question remains as to why the lipid transfer activity of SR-B1 promotes viral entry. We know that SR-B1-mediated lipid transfer from HDL results in local increases in the cholesterol content of cell membranes8,15. Cholesterol and the abundant presence of cholesterol within lipid rafts play essential roles in viral entry and fusion16,17,18,19, and cholesterol depletion from cellular membranes has been shown to inhibit SARS-CoV-2 infection20. We thus speculate that SARS-CoV-2 may exploit the physiological function of SR-B1 to achieve its entry and fusion processes.
To understand how SR-B1 and ACE2 coordinate viral entry, it is important to compare receptor expression pattern(s) and localization in lower respiratory tissues. In the current study, we found that lower respiratory tissues express SR-B1 and ACE2, consistent with their ability to support SARS-CoV-2 entry. In addition, SR-B1 is coexpressed with ACE2 in multiple extrapulmonary tissues including the retina and testis. The existing expression profiles of SR-B1 and ACE2 also indicate their coexpression in multiple metabolic organs8,21,22,23,24,25, which could indicate an enhanced degree of trophism for extrapulmonary tissues, thereby contributing to the multiple-organ pathologies of COVID-19 (ref. 26,27,28,29,30).
Cardiovascular disease and diabetes are associated with an increased risk of severe COVID-19. Approximately half of patients with COVID-19 have chronic underlying diseases, mainly cardiovascular and cerebrovascular diseases and diabetes31,32,33. In addition, increased COVID-19 mortality has been observed in patients with obesity or diabetes34. HDL-mediated cholesterol efflux and selective cholesterol transport are hallmarks of many chronic metabolic diseases35,36. Although our current data did not suggest that HDL worsens COVID-19, future studies examining serum lipid levels in patients with pre-existing conditions, and exploring their possible clinical and mechanistic links, may uncover novel mechanisms of disease.
ACE2 has been identified as a functional SARS coronavirus receptor both in cell lines and in vivo37. S protein-mediated ACE2 downregulation then contributes to the severity of lung pathologies38. Commonalities between SARS-CoV-2 and SARS-CoV infection suggest that antibodies, peptides and small compounds targeting ACE2 can be used in the treatment of SARS-CoV-2. Identifying SR-B1 as a SARS-CoV-2 entry cofactor, we propose that drugs that target SR-B1 could act as antivirals that limit SARS-CoV-2 infection. As a proof of concept, we have shown that ITX 5601, a clinically approved inhibitor of HCV infection, strongly inhibits SARS-CoV-2 infection of cultured cells. We propose that further testing of ITX 5601 in animal models of SARS-CoV-2 infection is warranted. In summary, our results show that SARS-CoV-2 virus can exploit SR-B1 function to promote its cellular entry and highlight potential antiviral approaches to interfere with viral entry.
Methods
Reagents and antibodies
His-tagged SARS-2-S (GenBank accession no. QHD43416.1; Val16-Pro1213; SPN-C52H9), SARS-2-S1 (GenBack accession no. QHD43416.1; Val16-Arg685; S1N-C52H3), SARS-2-S2 (GenBank accession no. QHD43416.1; Ser686-Pro1213; S2N-C52H5) and SARS-2-RBD (GenBank accession no. QHD43416.1; Arg319-Lys 537; SPD-C52H3) were obtained from Acro Biosystems. ITX 5061 (HY-19900) was from MedChemExpress. Cholesterol (C8667), campesterol (C5157), epicholesterol (R207349), BLT-1 (SML0059), HDL (L8039), DMEM (high glucose, D5796) and protease inhibitors (11206893001) were from Sigma-Aldrich. Human serum (A3969001) and FBS (A3160901) were from Gibco. Lipofectamine 2000 (11668-027) was from Invitrogen. A tissue microassay (MNO661) was from Biomax. The Monolith His-Tag Labeling kit (MO-L018) was from NanoTemper Technologies.
α-Tubulin for immunoblotting (T9026, clone DM1A; 1:1,000 dilution), HRP-labelled anti-Flag (A8592, clone M2; 1:1,000 dilution), anti-human FITC-conjugated IgG (AP113F; 1:50 dilution) and anti-HA (H9658, clone HA-7; 1:20,000 dilution) were from Sigma-Aldrich. Antibodies against SR-B1 for immunoblotting (ab217318, clone EPR20190; 1:2,000 dilution) and immunohistochemistry (ab217318, clone EPR20190; 1:100 dilution) and antibodies against ACE2 for immunoblotting (ab108252, clone EPR4435(2); 1:1,000 dilution) and immunohistochemistry (ab108252, clone EPR4435(2); 1:50 dilution) were from Abcam. An antibody against ACE2 for FACS (21115-1-AP; 1:100 dilution) was from Proteintech. A PE anti-His antibody (362603, clone J095G46; 1:100 dilution) and an antibody against SR-B1 for FACS (363208, clone m1B9; dilution 1:100) were from BioLegend. The SARS-2-S mAb (GTX632604, clone 1A9; 1:1,000 dilution) was from GeneTex. The SARS-2-S1 antibody (40150-T62-COV2) for confocal microscopy was from Sino Biological. 1D2 mAb was from the laboratory of Wei Chen.
Plasmids
Expression plasmids for human HA-SR-B1 (H3784), Flag-ACE2 (H3673) and HA-ApoA1 (H3912) were obtained from Vigene Biosciences. Expression plasmids for SARS-2-S, VSV-G and the HIV-1 NL4-3 ΔEnv Vpr Luciferase Reporter Vector (pNL4-3-Luc-R-E-) were obtained from the laboratory of Wei Chen. The codon-optimized (for human cells) SARS-2-S gene was based on GenBank ID QHD43416.1. All constructs were sequence verified. The siRNAs targeting human genes were obtained from Invitrogen and had the following target sequences:
siSR-B1-1 (860): 5ʹ-CAAGUUCGGAUUAUUUGCUTT-3ʹ
siSR-B1-2 (1007): 5ʹ- CAUGAUCAAUGGAACUUCUTT-3ʹ
siSR-B1-3 (1423): 5ʹ-GCCUCUACAUGAAAUCUGUTT-3ʹ
Scrambled siRNA oligonucleotides from siSR-B1-3 were used as a control (siCtrl).
Cell culture and transfection
The 293T (CRL-3216), Vero E6 (CRL-1568), MDCK (CCL-34) and Hepa 1-6 (CRL-1830) cell lines were from the American Type Culture Collection. The Huh-7 (0403) cell line was from the Japanese Collection of Research Bioresources. The HeLa-hACE2 (012) cell line was from Beijing Vitalstar Biotechnology. All cell lines had been previously tested for mycoplasma contamination and were incubated in DMEM at 37 °C under a humidified atmosphere with 5% CO2. All media were supplemented with 10% FBS, 100 U ml−1 penicillin, 0.1 mg ml−1 streptomycin, 1× nonessential amino acid solution and 10 mM sodium pyruvate. Lipofectamine 2000 was used for transfection following the manufacturer’s protocol.
MST
MST assay was conducted as previously described39. SARS-2-S-His-tagged, SARS-2-S1-His-tagged and SARS-2-S2-His-tagged proteins were labelled with NT-647 dye for 30 min at room temperature, as recommended by the Monolith His-Tag Labeling Kit RED-tris-NTA protocol (NanoTemper Technologies, MO-L008). The binding buffer used for reactions (50 mM Tris-HCl (pH 7.5), 150 mM NaCl and 1 mM dithiothreitol) contained micelles of 0.5% Fos-choline 13, and a 16-step, twofold dilution curve of cholesterol and cholesterol derivatives ranged from 4 μM to 122 pM. Cholesterol or other sterol dry powders were mixed with binding buffer at 25 °C with mild agitation for 3 h. Labelled protein (100 nM, final concentration) in binding buffer was then added to a dilution curve of cholesterol or cholesterol derivatives at room temperature. Samples were loaded into standard glass capillaries (NanoTemper Technologies, MO-K022). MST was completed in three independent experiments on a Monolith NT.115 instrument (NanoTemper Technologies) running MO.Affinity Analysis (v.2.1.23333) with settings of 60–80% excitation power and 40% MST power at room temperature.
In the HDL-binding assay, labelled protein (100 nM, final concentration) in binding buffer (145 mM NaCl) was added to a dilution curve of HDL at room temperature, where the dilution curve of HDL ranged from 6.25 μg ml−1 to 190.7 pg ml−1 (16-step, twofold). Samples were loaded into standard glass capillaries (NanoTemper Technologies, MO-K022). MST was completed in three independent repeat experiments on a Monolith NT.115 instrument (NanoTemper Technologies) running MO.Control software with settings of 60–80% excitation power and 40% MST power at room temperature.
In the competition assay, 100 nM labelled SARS-2-S in binding buffer was incubated with 200 nM cholesterol either alone or with unlabelled SARS-2-S at the indicated concentrations.
Original data were obtained from MO.Affinity Analysis software. Fluorescence intensity values were averaged and expressed as the relative change over the results from the 0-μM ligand condition. The data were fitted to saturation binding equations using GraphPad Prism 8.0. Dotted lines indicate where data could not be fitted.
SPR
SPR data were recorded on an OpenSPR-XT system (Nicoya Lifesciences) with OpenSPR software (3.11.6949.28944). For all experiments, 145 mM NaCl was used as the running buffer. His-tagged SARS-2-S1 or SARS-2-S2 was dissolved to a final concentration of 30 μg ml−1 in 145 mM NaCl before immobilization on NTA sensors (SEN-AU-100-3-NTA, Nicoya Lifesciences). Approximately 2,000 response units of protein were immobilized on the chip with a running buffer composed of 145 mM NaCl. A series of HDL concentrations ranging from 0.313 to 10 μg ml−1 were tested at a flow rate of 20 μl min−1. The contact time was 300 s and the dissociation time was 300 s. When the data collection was finished for each cycle, the sensor surface was regenerated with PBS buffer. The binding affinity between HDL and SARS-2-S1 or SARS-2-S2 was analysed at 25 °C. The binding curves were displayed using the steady-state affinity method incorporated in the Trace Drawer (v.1.8, Nicoya Lifesciences).
Peptide–cholesterol binding assay
The synthetic peptides listed below, encompassing the CARC-CRAC region of SARS-2-S, were purchased from Scilight-Peptide. A control peptide with a random amino acid sequence was also included in the assay.
Control (Ctrl): KKKARVRIFLYGFLLQLLMPVWTMKKK
24–42: KKKLPPAYTNSFTRGVYYPDKVKKK
129–150: KKKKVCEFQFCNDPFLGVYYHKNNKKKK
267–277: KKKVGYLQPRTFLLKKK
445–461: KKKVGGNYNYLYRLFRKSNLKKK
776–806: KKKKNTQEVFAQVKQIYKTPPIKDFGGFNFSQILKKK
1,203–1,218: KKKLGKYEQYIKWPWYIWLKKK
The N-terminal and C-terminal Lys residues increase the solubility of the hydrophobic CARC-CRAC transmembrane segment. Replacing the Pro residue located between the CARC and the CRAC with Trp conferred intrinsic fluorescence upon 280-nm excitation, with maximum emission at 350 nm. Stock solutions of 5 mM peptide in dimethylsulfoxide were diluted to a final concentration of 5 μM in assay buffer containing 140 mM NaCl and 20 mM Tris (pH 8.5) supplemented with 2 mM Tris(2-carboxyethyl)phosphine hydrochloride solution (TCEP) and 2% (v/v) EtOH. Stock solutions of cholesterol in EtOH were diluted to final concentrations ranging between 0.5 and 50 μM in 500-μl volumes of peptide solution, which were incubated overnight at 25 °C with mild agitation. Fluorescence measurements were performed in triplicate on a Cary Eclipse fluorescence spectrophotometer (Agilent Technologies), with excitation and emission performed at 280 and 350 nm, respectively. All measured fluorescence values fell within the linear range of the instrument. Fluorescence intensity values were averaged and expressed as relative change over the 0-μM ligand condition. Data were fitted to saturation binding equations using GraphPad Prism v.8.0. Dotted lines indicate where data could not be fitted.
Pseudovirus production
All pseudoparticles were generated in 293T cells transfected with the HIV backbone vector pNL4-3.Luc.R-E together with the expression plasmids SARS-2-S or VSV-G. Pseudoparticle-containing supernatants were collected at 48 h and frozen to −80 °C after centrifugation at 2,000g for 5 min.
Pseudovirus entry assay
Cells were cultured in 96-well, transparent-bottom, flat culture plates (no. 3603, Corning) precoated with poly-d-lysine. To assess the inhibitory activity of chemicals, the indicated concentrations of chemicals were added to cells 4 h before infection. To determine the neutralization ability of antibodies, serially diluted antibodies were added to cells 1 h before infection. SARS-CoV-2pp preincubated with HDL at 25 °C for 2 h was applied to the cells pretreated with chemicals or antibodies and infected at 37 °C for 24 h. After SARS-CoV-2pp infection, the efficiency of viral entry was determined through a firefly luciferase assay. Specifically, cells were washed with PBS once, and then 16 μl of Cell Culture Lysis Reagent (E153A, Promega) was added to each well. Then, the plate was incubated for 15 min with rocking at room temperature, after which cell lysate (8 μl) from each well was added to a 384-well plate (no. 3574, Corning) followed by the addition of 16 μl of Luciferase Assay Substrate (no. E151A, Promega). Luciferase activity measurements were performed on a Spark 20M multimode microplate reader (Tecan) with Tecan Spark Control (v.2.1) software. All infection experiments were performed in a biosafety level-2 (BSL-2) laboratory. Cells without viruses, HDL and chemicals were used as blank controls, and cells without chemicals and HDL were used as viral controls. All the infection experiments were performed in a BSL-2 laboratory.
Western blot analysis and immunoprecipitation
Cells were lysed in NP40 cell lysis buffer with fresh protease inhibitors. Supernatants were separated by SDS–PAGE after centrifugation and transferred to polyvinylidene difluoride membranes for immunoblot analyses using the indicated primary antibodies: anti-Flag (1:5,000), anti-HA (1:5,000), anti-SR-B1 (1:3,000), anti-ACE2 (1:1,000) and anti-α-Tubulin (1:8,000). An aliquot of the total lysate (5%, v/v) was included as a control for the interaction assay and immunoprecipitation was performed with the indicated antibodies. Anti-rabbit or anti-mouse HRP-conjugated antibodies were then applied after three washes and the antigen–antibody complexes were visualized using chemiluminescence by a Tanon 5200 chemiluminescent imaging system, and analysed by Tanon Gelcap (v.5.22).
Infection with authentic SARS-CoV-2
The SARS-CoV-2 strain (BetaCoV/Beijing/IME-BJ01/2020) used in the present study was originally isolated from a patient with COVID-19 returning from Wuhan, China with patient consent, and was stored at −80 °C in the State Key Laboratory of Pathogen and Biosecurity at Beijing Institute of Microbiology and Epidemiology40. All the experiments involving viruses were performed in the BSL-3 laboratory of the Beijing Institute of Microbiology and Epidemiology.
For experiments with HDL, SARS-CoV-2 isolate (MOI (multiplicity of infection) = 0.001) was preincubated with the indicated concentrations of HDL at 37 °C for 1 h before adding to the cells. After 1 h of infection, the above cells were washed three times with PBS before 200 μl of DMEM was added. At 3 h or 24 h postinfection, cells were collected for viral RNA extraction with a viral RNA kit (52906, Qiagen) according to the manufacturer’s instructions and detected by quantitative PCR with reverse transcription (RT–qPCR) assays with a One-Step PrimeScript RT–PCR kit (Takara, Japan) using SARS-CoV-2-specific primers on an Applied Biosystems 7500 Real-Time PCR System with QuantStudio Design & Analysis Software (v.1.51).
For experiments involving chemicals and antibodies, cells were cultured in 96-well plates at 37 °C overnight. The supernatant was discarded, and 100 μl of medium containing different concentrations of drugs was added to the wells of the plates and incubated for 4 h (chemicals) or 1 h (for antibodies) before infection. The procedure above was repeated.
The TaqMan primers for SARS-CoV-2 were as follows:
5ʹ-TCCTGGTGATTCTTCTTCAGG-3ʹ and 5ʹ-TCTGAGAGAGGGTCAAGTGC-3ʹ.
The SARS-CoV-2 probe used was as follows:
5ʹ-FAM-AGCTGCAGCACCAGCTGTCCA-BHQ 1-3ʹ.
Copies per millilitre were determined using a synthetic RNA fragment to amplify the target region.
Flow cytometry
For surface SR-B1 or ACE2 expression analysis, cells were washed with PBS two times and incubated with an APC-conjugated SR-B1 (1:100) or anti-ACE2 (1:100) antibody, followed by a secondary donkey anti-rabbit antibody (1:200) conjugated to Alexa Fluor 488. Measurement of cellular fluorescence was determined by FACS. Thirty thousand events were registered for each experiment. Cellular fluorescence was quantitated as the mean fluorescence intensity or the percentage of positive cells.
For SARS-2-S cell-surface binding, SARS-2-S proteins (140 nM) and HDL (6 μg ml−1) preincubated at 37 °C for 1 h were then added to the cells. After incubating at 4 °C for 30 min, the cells were washed two times with PBS containing 2% FBS and then incubated for 30 min at room temperature with a PE-conjugated antibody (PE anti-His tag). Then, the cells were washed again with PBS containing 2% FBS, after which binding was detected by flow cytometry. The cells were analysed on an Invitrogen Attune NxT Acoustic Focusing cytometer. Attune NxT Software (v.3.1.1243.0) and FlowJo v.10.0.7 software were used to process the data based on proper gating strategy (Extended Data Fig. 2c). At least 10,000 cells were analysed for each sample.
Confocal microscopy
Cells grown on poly-l-lysine-coated coverslips were fixed in 4% PFA for 10 min and then washed three times with PBS. For the viral entry assay, cells were permeabilized in 0.2% Triton X-100 in PBS and blocked with 2% BSA in PBS for 1 h. Nonpermeabilized cells were used for viral attachment assay. A SARS-2-S1 antibody and Alexa Fluor 555-labelled donkey anti-rabbit IgG (H+L) were used for immunofluorescence staining. Nuclear DNA staining was performed with DAPI (0.5 μg ml−1, Sigma-Aldrich, D9542). Fluorescent images were acquired under a Nikon A1 confocal microscope using Nikon A1 Elements software (v.4.20). The images were processed using Volocity (v.6.1.1, PerkinElmer). Viral attachment to or entry into cells was quantified using an NIS-Elements Advanced Research Imaging software to measure the relative fluorescence intensity. The DAPI channel was used to count the number of cells per image. Fluorescence was divided by cell count to calculate the fluorescence per cell in each condition.
Immunohistochemistry
Immunohistochemical staining for ACE2 and SR-B1 was performed on the paraffin-embedded human normal organ tissue microarray (MNO661, Biomax). Antigen retrieval was performed by placing the slides in 10 mM sodium citrate buffer (pH 6.0) and maintaining at a sub-boiling temperature for 10 min. After blocking in 1% normal goat serum, the sections were incubated with ACE2 or SR-B1 monoclonal antibodies at 4 °C overnight in a humidified chamber, which was followed by an incubation with HRP-labelled goat anti-mouse IgG secondary antibody (Beijing ZSGB Biotechnology, ZDR-5307). Subsequently, the sections were incubated with a goat anti-rabbit IgG secondary antibody (HRP) (Beijing ZSGB Biotechnology, PV9001) for 60 min and then visualized with 3,30-diaminobenzidine tetrahydrochloride (DAB). The slices were viewed under an Olympus microscope.
Statistical methods
In the present study, GraphPad Prism 8.0 was used for statistical calculations and data plotting. Differences between two independent samples were evaluated by two-tailed Student’s t-tests. Differences between multiple samples were analysed by one-way analysis of variance (ANOVA) followed by Bonferroni’s post hoc analysis. The correlation between SR-B1 expression and the efficiency of viral entry was determined by Spearman’s nonparametric test. All tests were two-tailed, unless otherwise indicated. We considered P ≤ 0.05 to be statistically significant. Significance values were set as follows: NS (not significant), P > 0.05; *P < 0.05; **P < 0.01; ***P < 0.001. Further information on the statistics methods used in this paper can be found in the ‘Statistics and Reproducibility’ file in the Supplementary Information.
Reporting Summary
Further information on research design is available in the Nature Research Reporting Summary linked to this article.
Data availability
The data that support the findings of this study are available from the corresponding author upon reasonable request. Source data are provided with this paper.
References
World Health Organization. Coronavirus Disease (COVID-19) Pandemic. https://www.who.int/emergencies/diseases/novel-coronavirus-2019 (2020).
Pelkmans, L. & Helenius, A. Insider information: what viruses tell us about endocytosis. Curr. Opin. Cell Biol. 15, 414–422 (2003).
Wang, H. et al. SARS coronavirus entry into host cells through a novel clathrin- and caveolae-independent endocytic pathway. Cell Res. 18, 290–301 (2008).
Walls, A. C. et al. Structure, function, and antigenicity of the SARS-CoV-2 spike glycoprotein. Cell 181, 281–292.e286 (2020).
Hoffmann, M. et al. SARS-CoV-2 cell entry depends on ACE2 and TMPRSS2 and is blocked by a clinically proven protease inhibitor. Cell 181, 271–280.e8 (2020).
Chi, X. et al. A neutralizing human antibody binds to the N-terminal domain of the Spike protein of SARS-CoV-2. Science 369, 650–655 (2020).
Shen, W. J., Asthana, S., Kraemer, F. B. & Azhar, S. Scavenger receptor B type 1: expression, molecular regulation, and cholesterol transport function. J. Lipid Res. 59, 1114–1131 (2018).
Shen, W. J., Azhar, S. & Kraemer, F. B. SR-B1: a unique multifunctional receptor for cholesterol influx and efflux. Annu. Rev. Physiol. 80, 95–116 (2018).
Kolleck, I., Sinha, P. & Rustow, B. Vitamin E as an antioxidant of the lung: mechanisms of vitamin E delivery to alveolar type II cells. Am. J. Respir. Crit. Care Med. 166, S62–S66 (2002).
Kolleck, I. et al. HDL is the major source of vitamin E for type II pneumocytes. Free Radic. Biol. Med. 27, 882–890 (1999).
Catanese, M. T. et al. Role of scavenger receptor class B type I in hepatitis C virus entry: kinetics and molecular determinants. J. Virol. 84, 34–43 (2010).
Fantini, J., Di Scala, C., Baier, C. J. & Barrantes, F. J. Molecular mechanisms of protein–cholesterol interactions in plasma membranes: functional distinction between topological (tilted) and consensus (CARC/CRAC) domains. Chem. Phys. Lipids 199, 52–60 (2016).
Masson, D. et al. Increased HDL cholesterol and apoA-I in humans and mice treated with a novel SR-BI inhibitor. Arterioscler. Thromb. Vasc. Biol. 29, 2054–2060 (2009).
Raldua, D. & Babin, P. J. BLT-1, a specific inhibitor of the HDL receptor SR-BI, induces a copper-dependent phenotype during zebrafish development. Toxicol. Lett. 175, 1–7 (2007).
Sorci-Thomas, M. G. & Thomas, M. J. High density lipoprotein biogenesis, cholesterol efflux, and immune cell function. Arterioscler. Thromb. Vasc. Biol. 32, 2561–2565 (2012).
Bajimaya, S., Frankl, T., Hayashi, T. & Takimoto, T. Cholesterol is required for stability and infectivity of influenza A and respiratory syncytial viruses. Virology 510, 234–241 (2017).
Osuna-Ramos, J. F., Reyes-Ruiz, J. M. & Del Angel, R. M. The role of host cholesterol during flavivirus infection. Front. Cell. Infect. Microbiol. 8, 388 (2018).
Dou, X. et al. Cholesterol of lipid rafts is a key determinant for entry and post-entry control of porcine rotavirus infection. BMC Vet. Res. 14, 45 (2018).
Li, G. M., Li, Y. G., Yamate, M., Li, S. M. & Ikuta, K. Lipid rafts play an important role in the early stage of severe acute respiratory syndrome-coronavirus life cycle. Microbes Infect. 9, 96–102 (2007).
Radenkovic, D., Chawla, S., Pirro, M., Sahebkar, A. & Banach, M. Cholesterol in relation to COVID-19: should we care about it? J. Clin. Med. 9, 1909 (2020).
Julovi, S. M. et al. Apolipoprotein A-II plus lipid emulsion enhance cell growth via SR-B1 and target pancreatic cancer in vitro and in vivo. PLoS ONE 11, e0151475 (2016).
Johnson, A. C. M., Yabu, J. M., Hanson, S., Shah, V. O. & Zager, R. A. Experimental glomerulopathy alters renal cortical cholesterol, SR-B1, ABCA1, and HMG CoA reductase expression. Am. J. Pathol. 162, 283–291 (2003).
Hardenberg, J. B. & Luft, F. C. Covid-19, ACE2 and the kidney. Acta Physiol. (Oxf.) 230, e13539 (2020).
Zhang, H. et al. Specific ACE2 expression in small intestinal enterocytes may cause gastrointestinal symptoms and injury after 2019-nCoV infection. Int. J. Infect. Dis. 96, 19–24 (2020).
Liu, F. et al. ACE2 expression in pancreas may cause pancreatic damage after SARS-CoV-2 infection. Clin. Gastroenterol. Hepatol. 18, 2128–2130 e2122 (2020).
Seah, I. & Agrawal, R. Can the coronavirus disease 2019 (COVID-19) affect the eyes? A review of coronaviruses and ocular implications in humans and animals. Ocul. Immunol. Inflamm. 28, 391–395 (2020).
Hollstein, T. et al. Autoantibody-negative insulin-dependent diabetes mellitus after SARS-CoV-2 infection: a case report. Nat. Metab. 2, 1021–1024 (2020).
Cheng, Y. et al. Kidney disease is associated with in-hospital death of patients with COVID-19. Kidney Int. 97, 829–838 (2020).
Zhang, C., Shi, L. & Wang, F. S. Liver injury in COVID-19: management and challenges. Lancet Gastroenterol. Hepatol. 5, 428–430 (2020).
Zhang, H. et al. Digestive system is a potential route of COVID-19: an analysis of single-cell coexpression pattern of key proteins in viral entry process. Gut 69, 1010–1018 (2020).
Lai, C. C., Shih, T. P., Ko, W. C., Tang, H. J. & Hsueh, P. R. Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2) and coronavirus disease-2019 (COVID-19): the epidemic and the challenges. Int. J. Antimicrob. Agents 55, 105924 (2020).
Bajgain, K. T., Badal, S., Bajgain, B. B. & Santana, M. J. Prevalence of comorbidities among individuals with COVID-19: a rapid review of current literature. Am. J. Infect. Control https://doi.org/10.1016/j.ajic.2020.06.213 (2020).
Chen, N. et al. Epidemiological and clinical characteristics of 99 cases of 2019 novel coronavirus pneumonia in Wuhan, China: a descriptive study. Lancet 395, 507–513 (2020).
Ceriello, A. et al. Issues of cardiovascular risk management in people with diabetes in the COVID-19 era. Diabetes Care 43, 1427–1432 (2020).
Assmann, G. & Gotto, A. M. Jr. HDL cholesterol and protective factors in atherosclerosis. Circulation 109, III8–III14 (2004).
Rashid, S. & Genest, J. Effect of obesity on high-density lipoprotein metabolism. Obes. (Silver Spring) 15, 2875–2888 (2007).
Li, W. et al. Angiotensin-converting enzyme 2 is a functional receptor for the SARS coronavirus. Nature 426, 450–454 (2003).
Glowacka, I. et al. Differential downregulation of ACE2 by the spike proteins of severe acute respiratory syndrome coronavirus and human coronavirus NL63. J. Virol. 84, 1198–1205 (2010).
Jerabek-Willemsen, M., Wienken, C. J., Braun, D., Baaske, P. & Duhr, S. Molecular interaction studies using microscale thermophoresis. Assay Drug Dev. Technol. 9, 342–353 (2011).
Zhang, N. N. et al. A thermostable mRNA vaccine against COVID-19. Cell 182, 1271–1283.e1216 (2020).
Acknowledgements
We thank the National Key Research and Development Programme of China (grant no. 2018YFA0900800), the National Natural Science Foundation of China (grant nos. 81671973, 31670761, 31872715, 81773205 and 81572620), the Beijing Natural Science Foundation (grant nos. 5182029 and 5182030) and the Shandong Provincial Natural Science Foundation of China (grant no. ZR2015HM003) for their support. We also thank Q. Chang for the MST data collection at the Protein Preparation and Characterization Platform of the Tsinghua University Technology Centre for Protein Research. Extended Data Fig. 7 was created and exported with BioRender.com under a paid subscription.
Author information
Authors and Affiliations
Contributions
C.W., L.W., Q.Y., Xiaolin Wang, J.Z., Xiaopan Yang, Y. Zhang, J.S., J.G., H.Y., H. Li, W.Z., N.W., Y.P., Y.D., D.L., H. Lin and J.F. performed the experiments. C.F., Xiaoli Yang, Y.W., Xuejun Wang, J.L., Z.Z., R.W., P.D., Y. Zong and F.Y. provided reagents and intellectual input. C.Q., C.W., R.Z., W.C., Q.G., Y.C. and H.Z. designed and coordinated the study and wrote the manuscript. All authors read and approved the manuscript.
Corresponding authors
Ethics declarations
Competing interests
The authors declare no competing interests.
Additional information
Peer review information Nature Metabolism thanks the anonymous reviewers for their contribution to the peer review of this work. Primary Handling Editor: George Caputa.
Publisher’s note Springer Nature remains neutral with regard to jurisdictional claims in published maps and institutional affiliations.
Extended data
Extended Data Fig. 1 SARS-2-S binds to cholesterol and HDL.
a, Competitive binding of the indicated concentrations of unlabeled SARS-2-S with NT-647-NHS dye-labeled SARS-2-S in 0.5% fos-choline 13 micelles containing 200 nM cholesterol. The IC50 was determined by the Hill slope. n = 3 independent biological experiments. b, Kinetic profile of interactions between SARS-2-S2 and HDL by SPR analysis. c, Immunoprecipitation analysis in 293T cells transfected with Flag-SARS-2-S and HA-ApoA1. The approximate molecular weight (kDa) marker positions are indicated to the left of the blot. d, e, MST analysis of interactions between SARS-2-RBD and cholesterol (d) or HDL (e). The data were derived from the effects of cholesterol or HDL on the fluorescence decay of fluorescently labeled proteins. The EC50 was determined by the Hill slope. n = 3 independent biological experiments.
Extended Data Fig. 2 SARS-2-S-HDL binding enhances SARS-CoV-2 entry.
a, Huh-7 cells were inoculated with SARS-CoV-2pp in 10% FBS, and pseudotyped viral entry was analyzed by luciferase activity at 48 h after infection. n = 4 independent biological experiments. P < 0.0001 for Cells only vs SARS-CoV-2pp by two-tailed Student’s t-tests. b, Flow cytometry analysis of SARS-2-S adhesion to HeLa-hACE2 cells. The MFI was quantified from Fig. 2f. n = 3 independent biological experiments. P = 0.0002 for 0.1% FBS vs HDL (0.05 µg/mL), P < 0.0001 for 0.1% FBS vs HDL (0.5 µg/mL), P < 0.0001 for 0.1% FBS vs HDL (5 µg/mL) by one-way ANOVA and Bonferroni’s post hoc analysis. c, Gating strategy of flow cytometry. Cells were first gated on the basis of their scatter properties and single cells were identified using FSC-H vs. FSC-W. Spike-His-PE positive cells were then determined from a negative control with a threshold of 0.25%. The data are the mean ± SEM. ***P < 0.001 by two-tailed Student’s t-tests.
Extended Data Fig. 3 Analysis and modulation of SR-B1 expression in multiple human and animal cell lines.
a, b, c, Flow cytometry (a-b) or immunoblot (c) analysis of ACE2 and SR-B1 expression in the indicated cell lines. n = 3 independent biological experiments (b). d, e, Immunoblot analysis of SR-B1 expression in Huh-7 cells transfected with HA-SR-B1 from Fig. 3a (d) or transfected with three siRNA oligos for SR-B1 from Fig. 3b (e). α-Tubulin was used as the equal loading control. No. 3 oligos (1423; siSR-B1-3) were used for the pseudotyped viral infection assay. f, Flow cytometry analysis of SR-B1 expression in Huh-7 cells transfected with three siRNA oligos for SR-B1 in different combinations. g, h, Immunoblot analysis of SR-B1 expression in Huh-7 cells transfected with siSR-B1-3 from Fig. 3d (g) or Vero E6 cells transfected with HA-SR-B1 from Fig. 3e (h). α-Tubulin was used as the equal loading control. The results shown are representative of three independent experiments. The data are the mean ± SEM.
Extended Data Fig. 4 SR-B1 expression confers susceptibility to SARS-CoV-2 infection.
a, b, c, Immunoblot analysis (a) or flow cytometry analysis (b-c) of ACE2 and SR-B1 expression in the indicated cell lines transfected with plasmids encoding ACE2 and or SR-B1 from Fig. 3f, g and Extended Data Fig. 4d. n = 3 independent biological experiments (c). d, MDCK cells were transfected with plasmids encoding ACE2, SR-B1 or both and then challenged with SARS-CoV-2pp in solutions containing 0.1% FBS or 6 μg/mL HDL. n = 3 independent biological experiments. P < 0.0001 for HDL SR-B1 vs HDL ACE2 + SR-B1, P = 0.0001 for HDL ACE2 vs HDL ACE2 + SR-B1 by one-way ANOVA and Bonferroni’s post hoc analysis. e, Immunoblot analysis of ACE2 and SR-B1 expression in 293 T cells transfected with Flag-ACE2 together with increasing concentrations of HA-SR-B1 from Fig. 3h. The data are the mean ± SEM. ***P < 0.001.
Extended Data Fig. 5 SR-B1 antagonists block SARS-CoV-2pp infection.
a, Immunoblot analysis of SR-B1 expression in Huh-7 cells transfected with HA-SR-B1 or siSR-B1 from Fig. 4b–d. b, The bars in the graph represent the RFI from 50 cells per sample from Fig. 4b. n=50 from 3 biologically independent samples and five technical duplication for each sample. P< 0.0001 for siCtrl vs siSR-B1 by two-tailed Student’s t-tests. c, d, The percentage of SARS-2-S-positive cells (c) and the MFI of SARS-2-S (d) on the cell surface were quantified with isotype and SARS-2-S staining from Fig. 4e. n = 3 independent biological experiments. P = 0.0475 for HDL HA-V vs HDL HA-SR-B1 (c), P = 0.0115 for HDL HA-V vs HDL HA-SR-B1 (d) by two-tailed Student’s t-tests. e, Immunoprecipitation analysis in 293 T cells transfected with Flag-SARS-2-S. The approximate molecular weight (kDa) marker positions are indicated to the left of the blot. f, g, Huh-7 cells were preincubated with the indicated concentrations of ITX 5061 (f) or BLT-1 (g) for 48 h, and MTT was added to the cells before OD492 measurements. Signals obtained without compounds were used for normalization. n = 3 independent biological experiments. Nonsignificant (ns) by one-way ANOVA and Bonferroni’s post hoc analysis. h, i, Huh-7 cells preincubated with the indicated concentrations of ITX 5061 (h) or BLT-1 (i) were inoculated with SARS-CoV-2pp in 10% FBS, and pseudotyped viral entry was analyzed by luciferase activity at 48 h after infection. Signals obtained without compounds were used for normalization. n = 3 independent biological experiments. P < 0.0001 for 0 μM ITX 5061 vs 1.56 μM ITX 5061, P < 0.0001 for 0 μM ITX 5061 vs 6.25 μM ITX 5061, P < 0.0001 for 0 μM ITX 5061 vs 25 μM ITX 5061, P < 0.0001 for 0 μM ITX 5061 vs 100 μM ITX 5061 by one-way ANOVA and Bonferroni’s post hoc analysis (h). P = 0.0038 for 0 μM BLT-1 vs 6.25 μM BLT-1, P < 0.0001 for 0 μM BLT-1 vs 12.5 μM BLT-1, P < 0.0001 for 0 μM BLT-1 vs 25 μM BLT-1, P < 0.0001 for 0 μM BLT-1 vs 50 μM BLT-1 by one-way ANOVA and Bonferroni’s post hoc analysis (i). The data are the mean ± SEM. *P < 0.05, **P < 0.01, ***P < 0.001.
Extended Data Fig. 6 Coexpression of SR-B1 and ACE2 in multiple normal human tissues.
a, Immunohistochemical staining of liver or kidney tissues incubated with normal IgG, an anti-ACE2 antibody or an anti-SR-B1 antibody. To validate antibody specificity, the anti-ACE2 antibody was preincubated with recombinant His-ACE2 protein and the anti- SR-B1 antibody was preincubated with recombinant His-SR-B1 protein for 1 h before application to tissue. The results shown are representative of 2 independent biological experiments. b, Representative images of immunohistochemical staining for ACE2 and SR-B1 performed on a paraffin-embedded human normal organ tissue microarray with antibodies against ACE2 or SR-B1; counterstaining with hematoxylin was performed to show nuclei (blue). The scale bars indicate 200 μm or 20 μm, as indicated. The results shown are representative of 2 independent biological experiments.
Extended Data Fig. 7 Hypothetical model of the involvement of SR-B1 in the entry of SARS-CoV-2.
Step 1, SARS-2-S binds to cholesterol and HDL or one of its components. Step 2, SR-B1 augments SARS-CoV-2 attachment. Step 3, Host cell entry is initiated through interactions with ACE2.
Supplementary information
Supplementary Information
Statistics and reproducibility information for Figs. 1–4 and Extended Data Figs. 1–6.
Source data
Source Data Fig. 1
Statistical source data. .
Source Data Fig. 2
Statistical source data.
Source Data Fig. 3
Statistical source data.
Source Data Fig. 4
Statistical source data.
Source Data Extended Data Fig. 1
Statistical source data.
Source Data Extended Data Fig. 1
Unprocessed western blots.
Source Data Extended Data Fig. 2
Statistical source data.
Source Data Extended Data Fig. 3
Statistical source data.
Source Data Extended Data Fig. 3
Unprocessed western blots.
Source Data Extended Data Fig. 4
Statistical source data.
Source Data Extended Data Fig. 4
Unprocessed western blots.
Source Data Extended Data Fig. 5
Statistical source data.
Source Data Extended Data Fig. 5
Unprocessed western blots.
Rights and permissions
About this article
Cite this article
Wei, C., Wan, L., Yan, Q. et al. HDL-scavenger receptor B type 1 facilitates SARS-CoV-2 entry. Nat Metab 2, 1391–1400 (2020). https://doi.org/10.1038/s42255-020-00324-0
Received:
Accepted:
Published:
Issue Date:
DOI: https://doi.org/10.1038/s42255-020-00324-0
This article is cited by
-
Omicron Spike confers enhanced infectivity and interferon resistance to SARS-CoV-2 in human nasal tissue
Nature Communications (2024)
-
Role of marine natural products in the development of antiviral agents against SARS-CoV-2: potential and prospects
Marine Life Science & Technology (2024)
-
Scavenger receptor B1 facilitates the endocytosis of Escherichia coli via TLR4 signaling in mammary gland infection
Cell Communication and Signaling (2023)
-
Association of remnant cholesterol with depression among US adults
BMC Psychiatry (2023)
-
Lipid from electronic cigarette-aerosol both with and without nicotine induced pro-inflammatory macrophage polarization and disrupted phagocytosis
Journal of Inflammation (2023)