Table 3 Strongly predicted T-cell autoimmune epitope regions in human amyloidogenic proteins that contain experimentally validated aggregating peptides.

From: Autoimmune Responses to Soluble Aggregates of Amyloidogenic Proteins Involved in Neurodegenerative Diseases: Overlapping Aggregation Prone and Autoimmunogenic regions

Protein name, UniProt ID and Disease T-cell autoimmune epitope region(s)
Apolipoprotein A-I, 219-LPVLESFKVSFLSALEEYTKK-239
P02647 [25–267], Amyloidosis 8
Apolipoprotein C-II, 48-KLRDLYSKSTAAMSTYTGIFTDQVLSVLKGEE-79
P02655 [23–101],
Hyperlipoproteinemia 1B
α-Synuclein P37840 7-GLSKAKEGVVAAAEKT-22
[1–140] Parkinson 31-GKTKEGVLYVGSKTKEGVV-49
disease 1 63-VTNVGGAVVTGVTAVA-78
β2-Microglobulin, 55-EHSDLSFSKDWSFYLLYYTEFTPTEKDEY-78
P61769 [21–119],
Hypercatabolic hypoproteinemia
β2-Microglobulin, 79-ACRVNHVTLSQPKIV-93
P61769 [21–119],
Hypercatabolic hypoproteinemia
Calcitonin, P01258 [85–116], 13-TQDFNKFHTFPQTAIGVGA-31
Medullary carcinoma
of thyroid56
Cystatin-C, 41-MYHSRALQVVRARKQIVAGVNYFLDVELGRTTC-73
P01034 [27–146],
Amyloidosis 6
Gelsolin P06396 [28–782], 183-FNNGDCFILDLGNNIHQWCGSNSNRYERLKATQVSKGIRD-222
Amyloidosis 5
IAPP (Amylin) P10997 [34–70], 17-VHSSNNFGAILSSTNVGSNTY-37
Type 2 diabetes
Insulin B-chain P01308 [25–54], 5-HLCGSHLVEALYLVCGER-22
Diabetes mellitus,
Injection localized amyloidosis56
Kerato-epithelin, 462-RGRYGTLFTMDRVLTPPMGTVMDVLKGDNRFSMLVAAIQSAGLTET-507
Q15582 [24–683],
Corneal dystrophy
Lactoferrin, P02788 [20–710], 538-NAGDVAFVKDVTVLQNTDGNN-558
Familial subepithelial corneal
amyloidosis57
Lung Surfactant Protein C, 6-CPVHLKRLLIVVVVVVLIVVVIVGALLMGL-35
P11686 [24–58],
Pulmonary surfactant metabolism dysfunction 2
Lysozyme C, P61626 [19–148], 4-ERCELARTLKRLGMDGYRGISLANWMCLAKWESGYNT-40
Amyloidosis 8 51-STDYGIFQINSRYWCNDGK-69
Major Prion Protein, 81-SKPKTNMKHMAGAAAAGAVVGGLGGYMLGSAMSRPII-117
P04156 [23–230], 147-YSNQNNFVHDCVNITIKQHTV-167
Creutzfeldt-Jakob disease (CJD)
Pmel, P40967 [25–661] 74-PDGQVIWVNNTIINGSQV-91
378-PAEVSIVVLSGTTAAQVTTTEWVETTARELPIP-410
570-GQVPLIVGILLVLMAVVLASLIYRRRLMKQDF-601
Natriuretic peptides B, 55-EVATEGIRGHRKMVLYTLRAPRSPKMV-81
P16860 [27–134],
Isolated Atrial Amyloidosis58
Transthyretin, P02766 [21–147], Hyperthyroxinemia, dystransthyretinemic, Carpal tunnel syndrome 1 9-KCPLMVKVLDAVRGSP-24
101-GPRRYTIAALLSPYSYSTTAVVTNPK-126
  1. Strongly predicted (percentile ≤1.0) T-cell autoimmune epitopes in each amyloidogenic protein are overlapping and were therefore clubbed into T-cell autoimmune epitope regions. These regions were then searched for the incidence of experimentally validated aggregating peptides and are shown in bold fonts. The protein sequence codes and associated disease names were primarily taken from UniProt29. In the cases where this information is not available in UniProt, the disease names were taken from literature searches and citations are provided in this table.