Skip to main content

Thank you for visiting nature.com. You are using a browser version with limited support for CSS. To obtain the best experience, we recommend you use a more up to date browser (or turn off compatibility mode in Internet Explorer). In the meantime, to ensure continued support, we are displaying the site without styles and JavaScript.

Improved calcium sensor GCaMP-X overcomes the calcium channel perturbations induced by the calmodulin in GCaMP

Abstract

GCaMP, one popular type of genetically-encoded Ca2+ indicator, has been associated with various side-effects. Here we unveil the intrinsic problem prevailing over different versions and applications, showing that GCaMP containing CaM (calmodulin) interferes with both gating and signaling of L-type calcium channels (CaV1). GCaMP acts as an impaired apoCaM and Ca2+/CaM, both critical to CaV1, which disrupts Ca2+ dynamics and gene expression. We then design and implement GCaMP-X, by incorporating an extra apoCaM-binding motif, effectively protecting CaV1-dependent excitation–transcription coupling from perturbations. GCaMP-X resolves the problems of detrimental nuclear accumulation, acute and chronic Ca2+ dysregulation, and aberrant transcription signaling and cell morphogenesis, while still demonstrating excellent Ca2+-sensing characteristics partly inherited from GCaMP. In summary, CaM/CaV1 gating and signaling mechanisms are elucidated for GCaMP side-effects, while allowing the development of GCaMP-X to appropriately monitor cytosolic, submembrane or nuclear Ca2+, which is also expected to guide the future design of CaM-based molecular tools.

Introduction

Calcium (Ca2+) is one of the most versatile and ubiquitous messengers in biology, and diverse extracellular signals and intracellular events are encoded into spatiotemporal Ca2+ dynamics to regulate numerous vital processes1, such as proliferation, transcription, metabolism, exocytosis, contraction, apoptosis, etc. Consequently, enormous efforts have been devoted to develop and improve molecular tools to monitor and quantify the spatial-temporal dynamics of cell Ca2+. Fluorescent imaging with genetically encoded Ca2+ indicators (GECIs) has achieved rapid progress in visualizing Ca2+ at the levels of cell populations, single cells or subcellular compartments2. Among them, the fluorescence-intensity and single-fluorophore based sensor GCaMP is one of the most successful and popular type of GECIs up to date, mostly owing to its capability of Ca2+ measurement with impressive signal-noise ratio (SNR) and rapid response kinetics after continuous improvements and updates from GCaMP, GCaMP3 up to current GCaMP6 (Supplementary Fig. 1)3,4,5,6,7. GCaMP design is based on Ca2+-binding protein calmodulin (CaM) as the sensing element, which interacts with Ca2+/CaM-binding motif M13 from myosin light chain kinase (MLCK), and a circularly permuted green fluorescent protein (cpEGFP). Ca2+-dependent interactions between CaM and its binding motifs switch the protonation state of fluorescent proteins, hence altering spectral properties of the chromophore3,4,8. However, in practice GCaMP reportedly causes unexpected and unwanted “side-effects” in multiple aspects. The major concern is about cell damages induced by GCaMP. For instance, GCaMP expression, usually in chronic terms, could impair the general health of cells and tissues, including cardiomegaly/hypertrophy in the heart of GCaMP2 transgenic mice (resembling exogenous CaM overexpression)4,9, and cytotoxicity or death in neurons5,10. These side-effects seem to be closely associated with abnormal accumulation of GCaMP filling in the nuclei, often accompanied by attenuation and/or distortion of Ca2+ dynamics as evidenced in neurons5,10,11,12. Another line of evidence, which is less obvious, comes from functional studies reporting the alterations of physiological Ca2+ and intrinsic excitability, e.g., gain of function in firing rates was observed from hippocampal neurons of GCaM5G transgenic mice13. And recently, multiple lines of GCaMP6 mice are reported to exhibit major abnormalities in their brain activity14. According to most reports, these problems could be simply attributed to technical concerns of GCaMP probes. In fact, the actual levels of any sensors or probes based on interactions with the targeted analytes in live cells often raise concerns. The potential problems are of two-fold: an excessive amount of exogenous sensors would bring up “over-buffering” issues15,16 whereas insufficient sensors would result into rather weak readouts in association with low SNR and loss of sensitivity17. However, these general aspects could not explain the above atypical side-effects particular to GCaMP, thus unable to provide any tangible and specific solution.

CaM is ubiquitous signal protein in cells acting as either apoCaM (Ca2+-free CaM) or calcified CaM (Ca2+/CaM). Ca2+/CaM is widely involved in numerous Ca2+-signaling cascades including gene transcription; and apoCaM also regulates the functions of diverse proteins including ion channels18,19,20,21. We suspect that the problems of GCaMP might be due to its potential perturbations of signaling networks and normal protein functions pertaining to CaM. Nevertheless, it remains unclear what is the major cause/mechanism responsible for the side-effects of GCaMP. Neither is any solution available yet to overcome these problems still existing to the newest GCaMP610.

We looked into the mechanistic details underlying GCaMP perturbations in neurons, and made the following discoveries. First, GCaMP interferes with the gating of L-type Ca2+ channels (CaV1) in complex with CaM thus affecting Ca2+ influx and dynamics, evidently through the competition with distal carboxyl tail (DCT) of the channel and/or endogenous apoCaM pre-bound with the channel21,22. Second, GCaMP, often indicated by aberrant nuclear accumulation as the sign of severity, interferes with critical signaling events including cytonuclear CaM translocation and phosphorylation of transcription factor CREB (cAMP responsive element binding protein) in CaV1-dependent excitation–transcription (E–T) coupling23,24. To overcome these drawbacks in excitability (Ca2+ dynamics) and signaling (gene expression), we newly developed GCaMP-X as our solution, by engineering an additional apoCaM-binding motif and an extra tag ensuring subcellular localization into conventional GCaMP.

In summary, we unveil that GCaMP containing CaM interferes with gating and signaling of L-type calcium channels, which disrupts Ca2+ dynamics and gene expression. Based on these mechanistic insights, we propose, implement and validate new GCaMP-X with its CaM being protected, which not only improves the applicability, robustness and precision of GCaMP currently being distributed and utilized, but also provides important guidance for future development of GCaMP and other CaM-based sensors or actuators.

Results

GCaMP causes side-effects in neurons

According to previous reports5,7,10,25, GCaMP sensors could abnormally accumulate in the nucleus of neurons and cause multiple side-effects such as cell damages or death, altered neural functions and impaired sensing performance, more often evidenced from high levels or extended time of GCaMP expression with plasmid transfection or virus infection. Such phenomena were replicated in our experimental settings with cortical neurons infected with AAV-syn-GCaMP6f virus (Fig. 1a). In contrast to stable EGFP control, GCaMP6f exhibited a time-dependent trend of accumulation in the nucleus, which started with N/C (nuclear/cytosolic) ratio of 0.29 ± 0.02 (n = 16) in half a week, but gradually reaching 0.99 ± 0.01 (n = 82) at the timepoint of 3rd week (Fig. 1b). Such aberrant nuclear accumulation of GCaMP is reportedly problematic, usually accompanied by various side-effects. Indeed, as demonstrated by the apoptosis assay (Annexin V kit), at the time of 10th day (GCaMP N/C ratio of ~0.8) robust signals of apoptosis were detected from a large fraction (>60%) of neurons infected with AAV-Syn-GCaMP6f virus (Fig. 1c), whereas much less for control neurons infected with AAV-Syn-EGFP (~20%). To test the hypothesis that nuclear accumulation of GCaMP could underlie its side-effects in neurons, we examined and quantified the cytonuclear distribution of GCaMP in relation to neurite outgrowth. For cultured cortical neurons (5 days in vitro or DIV 5) transiently transfected with GCaMP3 cDNA, in two days after transfection, GCaMP3 distributions can be segregated into two extreme patterns by the criteria of N/C ratio of GCaMP3 fluorescence: nuclear-excluded (N/C ratio < 0.6, ~50% out of the total number of neurons) or nuclear-filled (N/C ratio > 1, ~10% of neurons) (Fig. 1d, e). Additional experiments with TagRFP-GCaMP3 confirmed that GCaMP3 fluorescent images indicative of basal Ca2+ in cells can very well represent the cytonuclear distribution of proteins (Supplementary Fig. 2). We then examined the potential neural damages due to nuclear accumulation of GCaMP, by tracing the neurite morphology indicated by green fluorescence in each neuron with the aid of wide-field confocal microscopy when necessary (Fig. 1d, f). Nuclear-filled group was also mimicked by NLS-GCaMP3-NLS constitutively expressing in the nucleus directed by the NLS (nuclear localization signal) tag. N/C ratio of GCaMP3 and the total length of neurites were calculated and correlated for individual neurons (Fig. 1g). As expected, nuclear-filled neurons were subject to significant reduction in neurite length compared to control neurons (Fig. 1g, horizontal line in grey), indicative of neural damages. Surprisingly, neurite outgrowth appeared to be promoted in neurons where GCaMP3 was evidently excluded from the nucleus and the neurite length in average was significantly above the control level. Thus, a strong (negative) correlation was clearly formed between N/C ratio of GCaMP and the total neurite length per neuron (Fig. 1g). Nuclear accumulation and cell damages have been associated with the overexpression level of GCaMP, which was confirmed here by a similar correlation analysis but indexed with GCaMP fluorescence levels (Supplementary Fig. 3). These data suggest that GCaMP caused side-effects of at least two folds. First, as often noticed and reported in GCaMP applications, we here explicitly demonstrated that nuclear GCaMP, as one red alert sign along with the time or level of GCaMP expression, caused detrimental effects on neurons leading to neurite or cell loss. Second, discovered in this study, cytosolic GCaMP of less expression level still significantly altered neurite growth. In neurons without high-level GCaMP expression, such aberrant morphogenesis (indicative of altered signaling) could still be problematic to neurons even without clear sign of nuclear invasion. In quantitative comparison to the control group, the total neurite length was increased by cytosolic GCaMP3 and decreased by nuclear GCaMP3, the latter of which was further supported by reduction in neurite length of neurons expressing NLS-GCaMP3-NLS (Fig. 1h). Further comparisons among different groups of neurons by Sholl analysis consistently demonstrated that nuclear GCaMP reduced morphological complexity whereas cytosolic GCaMP promoted neurites to grow with higher complexity (Fig. 1i).

Fig. 1
figure1

Side-effects of GCaMP on cortical neurons. a Abnormal nuclear accumulation of GCaMP. Cultured cortical neurons infected with GCaMP6 (AAV-Syn-GCaMP6f) virus were examined with confocal live-cell imaging. b Analyses indexed with nuclear/cytosolic (N/C) fluorescence ratio indicate time-dependent nuclear accumulation of GCaMP6, in contrast to stable GFP distribution. c GCaMP6 caused apoptosis. For cortical neurons infected with AAV-Syn-EGFP and AAV-Syn-GCaMP6f (green), tracing images of dendritic morphology (black and white) and confocal fluorescence images of Annexin V-kFluor594 (red) are shown. Arrows are to identify apoptotic neurons where both green and red fluorescence are present and the percentage of such neurons (per view) are counted (right, number of views in parentheses). d Subcellular distributions of YFP, GCaMP3 or NLS-GCaMP3-NLS overexpressed in cortical neurons. CFP fluorescence (NLS-CFP-NLS, upper) indicates the nucleus (blue) in cortical neurons. GFP images (lower row) of neurons expressing GCaMP3 (2 days after cDNA transfection) could be categorized into two major subgroups of interest: nuclear-excluded (N/C ratio < 0.6) and nuclear-filled (N/C ratio > 1.0), with the latter mimicked by neurons expressing NLS-GCaMP3-NLS. Such criteria (N/C ratio < 0.6 and >1) were applied throughout this study (unless indicated otherwise). e Based on the above criteria neurons of nuclear-filled group and nuclear-excluded group accounted for ~10% and ~50% of the total number of GCaMP3-expressing neurons, respectively (5 experiments). f Representative images tracing neurite morphology for cortical neurons from different subgroups. g Correlations between N/C ratio of GCaMP3 and neurite outgrowth. The grey line/area represents the total neurite length per neuron (control group). The eclipse enclosing most neurons contains two major areas representing the subgroups of nuclear-filled (cyan) and nuclear-excluded (pink). Nuclear GCaMP accumulation (N/C ratio) and neurite outgrowth (neurite length per neuron) are highly correlated (the correlation coefficient is −0.7). h, i Additional experiments and analyses for neurite morphology. Neurite outgrowth was quantified for the four subgroups by neurite length (h) and Sholl analysis (i), with the total number of cells in parentheses. Standard error of the mean (S.E.M.) and Student’s t-test (two-tailed unpaired with criteria of significance: *p < 0.05; **p < 0.01, and p < 0.001) were calculated when applicable

GCaMP perturbs CaV1.3 gating

Prior studies suspect that CaM contained in all versions of GCaMP (Fig. 2a and Supplementary Fig. 1) might be one factor responsible for various side-effects. However, it has been mostly attributed to trivial reasons, such as buffering effects of Ca2+-binding CaM4,16,26, one general concern common to any kind of Ca2+ (binding) probes which fail to explain the multi-fold side-effects here observed. We accidentally acquired some evidence that GCaMP might perturb CaM in CaV1 gating27, and thus CaV1-dependent signaling (e.g., excitation–transcription coupling)28. CaV1.3 is one major subtype of CaV1 channels expressed in neurons29 and tightly coupled to transcriptional signaling in the nucleus23,28. Also, CaV1-mediated E–T coupling could control neurite outgrowth30,31. Importantly, CaV1.3 is subject to apoCaM tuning due to a competitive balance gauged by the strength of DCT and ambient concentrations of apoCaM20,21. Following these lines of evidence related to CaM and CaV1, we directly compared native ICa of cortical neurons (mostly mediated by CaV1.3 in our protocol) between the control group and GCaMP6f group by whole-cell patch-clamp recording (Fig. 2b). Two major gating parameters were used to characterize Ca2+ currents. Ca2+-dependent inactivation (CDI) was quantified by strength/ratio factor SCa, and voltage-gated activation (VGA) was estimated by current density JCa (details see Fig. 2b). ICa recorded from GCaMP6f-overexpressing neurons was significantly different from the control, in that both CDI (SCa) and VGA (JCa) were augmented as shown by larger and “sharper” ICa traces at −10 mV, raising serious concerns that GCaMP would perturb native CaV1 in neurons. Before pursuing further, we consolidated such distortions of CaV1 currents to dissect out the detailed mechanisms.

Fig. 2
figure2

GCaMP interferes with CaV1.3 gating. a Schematic summary of GCaMP series. Upgrades of GCaMP (from GCaMP3 to GCaMP5 and GCaMP6) were achieved by mutations of the EGFP and CaM domains at the sites indicated by vertical letters (GCaMP3 vs. GCaMP), or by horizontal letters (GCaMP5G/6f/6m vs. GCaMP3). Details see Supplementary Fig. 1. b Effects on ICa were examined for neurons infected with AAV-Syn-GCaMP6f. Representative traces of Ca2+ current (left), SCa and JCa analyses (right) for native CaV1.3 in cortical neurons expressing GCaMP6. Neurons were treated with a cocktail recipe to isolate CaV1 current (mostly CaV1.3) and recorded at the membrane potential (V) of −10 mV. SCa (quantified as 1−ICa,50 /ICa, peak, where ICa,50 and ICa, peak represent the currents measured at 50 ms and the instantaneous peak, respectively) and JCa (pA/pF, the current density of ICa, peak) serve as the indices for CDI and VGA respectively. c Effects of GCaMP3 on recombinant α1DL. Representative Ca2+ current traces were compared for ICa recorded from HEK293 cells expressing long variant α1DL alone (left), or with GCaMP3 (right) at −10 mV. Ba2+ currents (rescaled) and Ca2+ currents (ICa) were shown as grey and red traces, respectively, with scale bars indicative of ICa amplitudes. CDI (SCa) and VGA (JCa) profiles at different membrane potentials are compared between α1DL control and α1DL overexpressed with GCaMP3 (differences highlighted by orange areas). d Effects of GCaMP3 on recombinant α1DS alone (left), or with GCaMP3 (right), in a similar fashion to c. Standard error of the mean (S.E.M.) and Student’s t-test (two-tailed unpaired with criteria of significance: *p < 0.05; **p < 0.01 and, ***p < 0.001) were calculated when applicable, and n.s. denotes “not significant”

The aberrant CaV1.3 gating due to GCaMP roughly resembled the tuning profile of CaV1.3 by apoCaM competition against DCT20,21. We then checked GCaMP3 effects on recombinant CaV1.3 channels in HEK293 cells. CaV1.3 long variant (α1DL), the major isoform of cortical CaV1, exhibited moderate CDI of intermediate SCa which could be upregulated when free apoCaM is abundantly present. Notably, GCaMP3 acted on α1DL channels in the fashion similar to WT apoCaM (Fig. 2c), that both CDI and VGA were significantly enhanced, consistent with the aforementioned effects on native ICa. On the other hand, does CaM as one motif of GCaMP really behave exactly the same as WT CaM? It is probably not the case, due to the following considerations. First, GCaMP of different versions all have certain mutations (very likely even more mutations in future versions) on CaM domain raising the possibility of defective CaM. Second, other domains of GCaMP may impair CaM functions. The CaM motif is surrounded with other motifs such as cpEGFP and M13 in GCaMP, which would structurally constrain the enclosed CaM domain from functioning as one ‘real’ CaM. In fact, as further analyzed with CaV1.3 and GCaMP variants, CaM motif in GCaMP has functional defects in both apoCaM and Ca2+/CaM forms mainly due to cpEGFP and M13. With another isoform of CaV1.3 lacking DCT (α1DS)32, we examined GCaMP3 effects on the gating (Fig. 2d). No change in VGA (JCa) was observed; however, the value of SCa (CDI) exhibited a moderate but confirmative attenuation since normally CDI of α1DS is very robust, maintaining at the constant level of ultrastrong CDI. Such alteration in CDI implied that Ca2+/CaM functions of GCaMP were impaired. In principle apoCaM pre-association with the channel is required for subsequent Ca2+/CaM-mediated CaV1 modulation. So how would GCaMP behave as apoCaM? GCaMP3 is able to win the competition against DCT or endogenous CaM to interact with the channel, shown by its effects on α1DL (Fig. 2c) and α1DS (Fig. 2d). However, further analysis demonstrated that GCaMP was only partially functioning as apoCaM because GCaMP with all the four Ca2+-binding sites knocked out (GCaM1234P) could not fully abolish CDI of α1DS as expected from the Ca2+-binding knockout CaM1234 (Supplementary Fig. 4c), indicative of impaired apoCaM affinity to the channel. In support, for α1DS-DCTF channels with ultrastrong DCT effects, GCaMP barely exhibited any apoCaM tuning in comparison to WT CaM (Supplementary Fig. 4d). In all above experiments with defective apoCaM or Ca2+/CaM from GCaMP, removal of M13 and cpEGFP eliminated the discrepant effects between WT CaM and CaM motif of GCaMP (Supplementary Fig. 4), also suggesting that the aforementioned potential effect of CaM mutations should be minimum, if there was any for GCaMP tested in this study.

In summary, GCaMP acts like CaM but with aberrant apoCaM and Ca2+/CaM functionalities, suggested by GCaMP perturbations on CaV1.3 gating.

GCaMP intervenes with excitation–transcription coupling

The excitation–transcription coupling is highly specific to CaV1 in complex with CaM, which starts from CaV1 activities, followed by Ca2+ binding to CaM proteins including the pre-associated CaM on the carboxyl terminus, Ca2+/CaM signaling back to the channel (such as CDI), Ca2+/CaM activation of CaMKII (CaM-dependent kinase II), CaM and CaMKII translocation to the nucleus, activation of nuclear CaM-dependent kinases and phosphorylation of CREB, eventually to gene transcription23,28. CaM plays essential roles in the whole E–T coupling, mediating Ca2+ signaling to CaV1 and other important proteins in the cytosol and also the nucleus21,24,33. GCaMP perturbs the gating of CaV1/CaM complex (Fig. 2), and may also affect the downstream signals along the E–T pathway. We then examined the level of phosphorylated CREB (pCREB) in cultured cortical neurons expressing GCaMP3 of different distributions (Fig. 3a). pCREB signals of each neuron were normalized by the mean intensity of pCREB fluorescence obtained from the control group. Normalized pCREB of GCaMP3-expressing neurons exhibited strong (negative) correlations with the N/C ratio (Fig. 3b) or expression level (Supplementary Fig. 5a) of GCaMP, resembling the high correlations previously obtained from neurite outgrowth (Fig. 1g and Supplementary Fig. 3). Grouped data from nuclear-excluded (N/C ratio < 0.6) and nuclear-filled (N/C ratio > 1 or NLS-tagged) neurons revealed that pCREB signals under normal physiological conditions (control group) were significantly decreased by nuclear GCaMP3 but aberrantly enhanced by cytosolic GCaMP3 (Fig. 3c), while the total CREB levels remained the same for all neurons (Supplementary Fig. 5b). Such pCREB changes in dual directions were mostly attributed to GCaMP effects on native ICa (Fig. 2b), providing the mechanistic linkage of nuclear/cytosolic GCaMP to aforementioned reduction/promotion of neurite branching and outgrowth (Fig. 1h). Particularly, GCaMP present in the nucleus could severely impair pCREB signaling by dominant negative effects of aberrant CaM-like activities, considering that CaM and CaM-interacting proteins plays important roles in nuclear signaling, many of which still await to uncover24,34.

Fig. 3
figure3

GCaMP perturbs CaV1-dependent E–T coupling. a GCaMP3 effects on CREB signaling. Cortical neurons (DIV 5) were transfected with YFP, GCaMP3 or NLS-GCaMP3-NLS for 2 days, then stained with pCREB antibodies under basal conditions. Green fluorescence represents the distributions of protein expression (upper) and red staining represents the levels of pCREB signals (lower), for all the four groups of neurons: YFP control, GCaMP3 nuclear excluded, GCaMP3 nuclear filled, and NLS-GCaMP3-NLS. b High correlation between subcellular localization of GCaMP3 (N/C ratio) and pCREB signals in cortical neurons expressing GCaMP3 (correlation coefficient = −0.8). Shades of areas indicate the neurons in the nuclear-excluded group (pink) and the nuclear-filled group (cyan). c Statistical summary of basal pCREB intensities. All neurons were normalized by the average value of pCREB fluorescence intensities calculated from the control group. df Cytonuclear translocations of CaM and GCaMP3 by confocal imaging. Endogenous CaM of cortical neurons translocated into nucleus under 5 min of 40 mM [K+]o stimulation, and recovered to the resting state when washed back by 2 h of 5 mM [K+]o (d). Representative images of fixed neurons for Hoechst (blue, indicating nucleus), YFP (indicating soma) and endogenous CaM (red, staining of CaM antibodies) at three different time points are shown in order (before 40 mM [K+]o, at the end of 5 min of 40 mM [K+]o stimulation, after washed back to 5 mM [K+]o for 2 h). 1 μM TTX was added throughout the experimental protocol in order to examine subthreshold activities of CaV1 channels. For comparison, neurons expressing TagRFP-GCaMP3 were similarly excited and monitored, during which localizations of GCaMP3 were confirmed by fluorescent TagRFP (e). RFP fluorescence at three representative time points (resting, stimulation, and wash-out) was analyzed with the index of N/C ratio and compared (paired Student’s t-test) for GCaMP3 localization, in addition to endogenous CaM (f). Standard error of the mean (S.E.M.) and Student’s t-test (two-tailed unpaired with criteria of significance: *p < 0.05; **p < 0.01, and p < 0.001) were calculated when applicable, and n.s. denotes “not significant”

With enhanced membrane excitability by high [K+]o stimulation, the potential perturbations of GCaMP on E–T coupling were examined. The majority of Ca2+ entry into the neuron in response to 20–40 mM [K+]o should be mediated by subthreshold CaV1 activities which subsequently drive transcriptional signaling including CaM translocation and CREB phosphorylation23. For control neurons, upon 40 mM [K+]o, endogenous CaM in the cytosol translocated to the nucleus, quantified by the increase of N/C ratio, which returned to the resting level after 5 mM [K+]o washout (Fig. 3d, f). As the robust and critical event within E–T coupling in control neurons28,33, cytonuclear translocation of CaM can serve as an acute form of index for transcription signaling since concurrently pCREB signals would be enhanced in response to high [K+]o (Supplementary Fig. 6a–c). In contrast, GCaMP3 behaved rather differently from endogenous CaM, in that cytosolic GCaMP3 did not translocate into the nucleus upon high [K+]o, as indicated by red fluorescence from the fusion protein of TagRFP-GCaMP3 (Fig. 3e). The impaired translocation of GCaMP might arise from dysregulated CaM-dependent signal transduction to targeted proteins, similar to CaV1.3 perturbations. The corresponding pCREB signals, however, nearly lost the responses to high [K+]o in neurons expressing GCaMP3, from either nuclear-excluded or nuclear-filled groups (Supplementary Fig. 6a–c). Acute translocation of endogenous CaM into the nucleus was also severely impaired in the neurons of nuclear-excluded group (Supplementary Fig. 6d). One plausible explanation is that cytosolic GCaMP could dominate the close vicinity to CaV1 channels, so that WT CaM is not (efficiently) recruited to initiate cytonuclear translocation. Notably, neurons of neither group could further respond to the stimulus in contrast to control neurons featured with activity-dependent CaM translocation (Fig. 3d, f) and CREB phosphorylation (Supplementary Fig. 6a–c), raising concerns on the potential impairment of neural plasticity and other subtle aspects of neural functions.

To this end, we discovered that GCaMP fundamentally altered E–T coupling regardless of its subcellular localization, mainly arising from its enclosed CaM mimicking the roles of WT CaM but with aberrant CaM functionalities, e.g., unexpected alternation of CaV1/CaM gating (cytosolic GCaMP), incapable of cytonuclear translocation, and perturbations on transcription signaling (nuclear GCaMP).

Principles and implementations of GCaMP-X design

Based on the perturbations of E–T coupling as the underlying mechanisms of GCaMP side-effects, we focused on the newly unveiled CaM-like roles of GCaMP to devise a new series of GCaMP-X sensors (Fig. 4a). The apoCaM binding onto CaV1 channels appeared to be the first and probably also the central problem. As the potential solution, after a trial-and-error process, we came up with the design of GCaMP-X by introducing an extra motif of apoCaM protection, originated from the IQ domain (dynamic CaM-binding domain) of neuromodulin (GAP-43)35. The protection motif was optimized to constitutively bind apoCaM with high affinity (Kd ≈ 2 μM), but bind Ca2+/CaM with much lower affinity (Kd = 2 − 40 μM) than M13 and other Ca2+/CaM targets36,37. Such apoCaM binding motif (CBM) was fused onto the N-terminus of conventional GCaMP. At rest, CBM/apoCaM would form the complex thus eliminating the interferences with gating and signaling of CaV1/CaM complex. When Ca2+ rises, high-affinity M13, but not CBM, would bind Ca2+/CaM, relieving the concern that Ca2+ sensing performance would be impaired by adding CBM. In addition to GCaMP-XO without any tag of localization signals, considering the particular importance of GCaMP distribution, we appended short tags onto the terminus of conventional GCaMP explicitly targeting different subcellular compartments (cytosol, membrane, and nucleus) as GCaMP-X variants of GCaMP-XC, GCaMP-XM, and GCaMP-XN. To validate such design, the prototypes of new sensors were coexpressed with CaV1.3, in hope to alleviate the interference with its gating (Fig. 4b, c). With GCaMP3-XO or GCaMP3-XC being present, α1DL or α1DS channels behaved indistinguishably from the control (no coexpression of sensors). Their comparable values of SCa (CDI) and JCa (VGA) indices confirmed successful isolation of the sensors from CaV1. In addition to recombinant CaV1.3 in HEK293 cells, the design of GCaMP-X was also validated with native ICa of cortical neurons infected with AAV viruses. The strong enhancement of CDI and VGA evidenced from conventional GCaMP (AAV-Syn-GCaMP6f) was diminished when GCaMP-X (AAV-Syn-GCaMP6m-XC) was applied to neurons instead (Fig. 4d).

Fig. 4
figure4

Design principles and basic validations of new GCaMP-X sensors. a Design principles of GCaMP-X. CaM binding motif (CBM) was fused onto N-terminus of GCaMP to tightly bind apoCaM at rest but with relatively low affinity (e.g., much lower than the M13 motif) to Ca2+/CaM, as the central strategy for GCaMP-X design. Also, additional tags of NES (nuclear export signal), NLS (nuclear localization signal) and MTS (membrane targeting signal) motifs could be appended onto C-terminus (or N-terminus), to control specific subcellular localization of GCaMP. Accordingly, a series of GCaMP-X sensors were developed, in addition to GCaMP-XO without any tag, including GCaMP-XC, GCaMP-XN, and GCaMP-XM, tagged with NES, NLS, and MTS respectively. b, c Design validation with GCaMP3 and recombinant CaV1.3 channels. Neither CDI nor VGA of α1DL channels (b) and α1DS channels (c) were altered by GCaMP3-XO or GCaMP3-XC overexpressed in HEK293 cells, as demonstrated by I Ca exemplars (top) and voltage-dependent CDI (middle) and VGA (bottom) profiles. d Validation of GCaMP6m-XC with neuronal CaV1.3 channels. Effects of GCaMP6-XC on α1DL gating were examined in cortical neurons infected with AAV-Syn-GCaMP6m-XC, indexed with SCa and JCa. Dotted lines represent GCaMP6f profiles (Fig. 2b). e, f GCaMP-X eliminated perturbations on subthreshold Ca2+ dynamics. For cortical neurons infected with AAV-Syn-GCaMP6m or AAV-Syn-GCaMP6m-XC, confocal fluorescent images depict Ca2+ dynamics in response to extracellular stimuli of 20 mM [K+]o, indexed by normalized fluorescence changes (ΔF/F0). Exemplar images (left), averaged curves of ΔF/F0 (middle) and statistical summary (right) are shown for GCaMP6m and GCaMP6m-XC. Particularly, peak ΔF/F0 and total calcium influx (rightmost, area integral within 300 s, in the units of ΔF/F0·s) were evaluated and compared (e). To confirm, similar experiments and analyses were performed with Fura-2 ratiometric Ca2+ imaging, indexed with fluorescence emission ratio F340/F380 achieved from 340 nm and 380 nm excitation (f). Standard error of the mean (S.E.M.) and Student’s t-test (two-tailed unpaired with criteria of significance: *p < 0.05; **p < 0.01, and ***p < 0.001) were calculated when applicable, and n.s. denotes “not significant”

Neurons expressing GCaMP6m produced significantly larger fluorescence signals (index with ΔF/F0, fold of change in fluorescence) and lasted longer period of time upon high [K+]o stimulation, suggesting more Ca2+ influx in comparison with GCaMP6m-XC (Fig. 4e), if similar sensing performance could be assumed for both GCaMP6m and GCaMP6m-XC (later proved). In addition, ratiometric Ca2+ fluorescence imaging with Fura-2 (5 μM) was performed, where F340/F380 ratio (F340 and F380, the fluorescence intensities of Fura-2 at excitation wavelength of 340 nm or 380 nm) was quantified as the index of (relative) Ca2+ concentration. Upon 40 mM [K+]o applied to neurons, conventional GCaMP resulted into aberrantly higher Ca2+ signals than GCaMP6m-XC (Fig. 4f). We assume that both GCaMP and GCaMP-X of similar expression levels (tens of μM) would also produce “buffering effects” about equally in average. So for the neurons loaded with 5 μM Fura-2, adding GCaMP or GCaMP-X would further attenuate the signals to the same extent. And importantly, in the context of such fair comparison between GCaMP and GCaMP-X, the larger Ca2+ signal should be attributed to abnormal GCaMP enhancement of Ca2+ currents mediated by CaV1 channels. Consistent with electrophysiological recordings, Ca2+ fluorescence imaging with GCaMP itself or organic dye Fura-2 demonstrated that Ca2+ dynamics of neurons would be perturbed by GCaMP acting on CaV1 channels, as further confirmed by isradipine blockage (Supplementary Fig. 7). These nontrivial alterations in transmembrane and cellular Ca2+ called up attentions to carefully analyze/revisit the data and conclusions acquired by conventional GCaMP, due to the importance of Ca2+ itself and also its critical roles in multiple physiological processes, in particular CaV1-dependent E–T coupling. Membrane-targeted version of GCaMP could be particularly useful for certain applications such as monitoring astrocyte calcium38, and here we implemented GCaMP3-XM by incorporating the membrane-tethering Lck tag at the N-terminus of GCaMP3-X. Similar to GCaMP3-XC vs. GCaMP3, GCaMP3-XM in comparison to GCaMP3M also corrected the aberrant enhancement of α1DL gating and overall Ca2+ influx, demonstrated by patch-clamp recordings and Fura-2 fluorescence imaging (Supplementary Fig. 8).

Thus, GCaMP-X eliminated the problems of Ca2+ distortion in the first place, which promised to alleviate aforementioned GCaMP perturbations on Ca2+ signaling.

GCaMP-X no longer perturbs CaV1 signaling in neurons

Subsequent to validation of GCaMP-X in the aspects of CaV1 gating, we examined the side-effects of conventional GCaMP on other processes of E–T coupling in cortical neurons (Figs. 1 and 3). Firstly, distribution analysis indexed with N/C ratio for GCaMP3, GCaMP3-XO, and GCaMP3-XC indicated that GCaMP3-XO or GCaMP3-XC no longer accumulated in the nucleus in contrast to GCaMP3 (Fig. 5a). Intriguingly, although fusion of a NES (nuclear export signal) tag did ensure the cytosolic localization, GCaMP-XO itself already very much relieved the abnormal nuclear accumulation. The reason responsible for abnormal GCaMP nuclear accumulation is not very clear yet. Basic properties of the protein itself may play a role, such as the size and shape. Or alternatively, such abnormality could be due to some unexpected interference with normal CaV1-dependent cytonuclear translocation processes. GCaMP-X protected apoCaM and subsequent Ca2+/CaM from interactions with endogenous proteins (e.g., CaV1 channels) in cells, as the potential mechanism to account for its cytosolic retention even without NES tagging (GCaMP-XO). Nevertheless, explicit tags should still be used if possible to explicitly control GCaMP-X distributions in different cellular conditions or contexts. Consistent with the profiles of N/C ratios, no more perturbation on pCREB signals (Fig. 5b) and neurite outgrowth (Fig. 5c) could be observed when GCaMP-XO or GCaMP-XC were overexpressed in cortical neurons.

Fig. 5
figure5

Additional validations of GCaMP-X. a Nuclear accumulation was substantially relieved for cortical neurons transfected with GCaMP-X. N/C fluorescence ratios indicative of GCaMP distributions in cortical neurons (DIV 5) were quantified 2 days after being transfected with GCaMP3, GCaMP3-XO or GCaMP3-XC. b GCaMP-X sensors no longer perturbed pCREB signals. For cortical neurons transfected with YFP, GCaMP3-XO or GCaMP3-XC, fluorescence of pCREB immunostaining (left) was normalized and compared (right). Dotted lines represent the mean values from nuclear-excluded GCaMP3 (pink) or nuclear-filled GCaMP3 (cyan) neurons, respectively (adopted from Fig. 3c). c Dysregulations of neurite outgrowth were diminished with GCaMP-X. Based on neurite tracing images (left), Sholl analysis (middle) and measurement of neurite length (right) were performed for cortical neurons transfected with YFP, GCaMP3-XO or GCaMP3-XC. Similar to b, dotted lines depict mean values of neurite length for nuclear-excluded GCaMP3 (pink) or nuclear-filled GCaMP3 (cyan) neurons (adopted from Fig. 1h). d Problematic nuclear accumulations were strongly attenuated for long-term viral expression of GCaMP6m-XC. Fluorescence indicative of sensor localization was mostly restricted to the cytosol of neurons infected with AAV-Syn-GCaMP6m-XC (GCaMP6-XC), as shown by representative images at different time points (upper panel). The temporal trend of N/C ratio for GCaMP6-XC (red) is distinct from that for GCaMP6f (black, GCaMP6 data adopted from Fig. 1b). e Apoptotic damages arising from GCaMP were strongly attenuated in GCaMP-XC expressing neurons. Fluorescence signals of apoptosis (red) were detected by Annexin V assay, to correlate with the expression of sensors (green). AAV-Syn-GCaMP6m-XC (GCaMP6-XC), EGFP and GCaMP6f (data adopted from Fig. 1c) were compared in a similar fashion to Fig. 1c. Standard error of the mean (S.E.M.) and Student’s t-test (two-tailed unpaired with criteria of significance: *p < 0.05; **p < 0.01, and ***p < 0.001) were calculated when applicable, and n.s. denotes “not significant”

Furthermore, we examined the neurons infected with AAV-Syn-GCaMP6m-XC vs. conventional GCaMP. Different from AAV-Syn-GCaMP6f (Fig. 1b), long-term infection of AAV-Syn-GCaMP6m-XC no longer caused the time-dependent nuclear accumulation in neurons; instead, rather stable cytosolic distributions were maintained: N/C ratio was 0.36 ± 0.01 (n = 69) even after three weeks (Fig. 5d). And for apoptosis associated with GCaMP, neurons of 10 days after virus infection of AAV-Syn-GCaMP6m-XC exhibited much weaker apoptotic signals of fluorescent Annexin V (<20% neurons), almost back to the level of control neurons (Fig. 5e), in contrast to the pronounced damages by GCaMP6f (>60%, Fig. 1c). To this end, all the known side-effects related to CaV1-dependent transcriptional signaling were all eliminated or strongly attenuated by our newly designed GCaMP-X.

In addition, we systematically examined other versions of GCaMP (e.g., GCaMP5G and GCaMP6m) also other representative CaM-based GECIs including D3cpv, CaMPARI and inverse pericam; and confirmed that all of them exhibited similar problems such as perturbations of CaV1.3 gating (both α1DS and α1DL), abnormal nuclear accumulations, or alterations of neuronal morphology (Supplementary Fig. 9 and Supplementary Fig. 10). Improved sensors such as GCaMP5-XC exhibited no or little side-effects on CaV1 gating and signaling in neurons, which not only further validated our design principle, but also strongly implied its generalizability to all other CaM-based GECIs.

As summarized in the scheme (Fig. 6a), GCaMP defects and mechanisms are clarified by this work, as the basis for the new design of GCaMP-X. In neurons, GCaMP sensors behave as CaM-like proteins. In consequence, CaV1 gating is perturbed through apoCaM and subsequent Ca2+/CaM modulation, causing unexpected increase of Ca2+ influx and distorted channel kinetics, accumulated nuclear GCaMP, impaired cytonuclear CaM translocation, aberrant gene transcription, and dysregulated growth of neurites. The general health of neurons is impaired and overall Ca2+ dynamics is altered, both of which would affect sensor readouts. In contrast, the GCaMP-X sensors containing extra protective motif of apoCaM-binding CBM successfully avoid all the above problematic effects on CaV1-dependent E–T coupling.

Fig. 6
figure6

Schematic summary and sensor performance for GCaMP and GCaMP-X. a GCaMP defects and advantages of GCaMP-X. In neurons, GCaMP sensors behave as CaM-like proteins perturbing CaV1 gating and distorting Ca2+ dynamics (1). The abnormal enhancement of CaV1 by cytosolic GCaMP underlies overgrown neurites. Different from endogenous CaM, GCaMP itself could no longer properly translocate into the nucleus in response to membrane excitation, which also dominant-negatively impairs the acute mobility of endogenous CaM. Once present in the nucleus (by accumulation or NLS), nuclear GCaMP perturbs transcription signaling and gene expression potentially through its aberrant CaM motif, impairing general health of neurons including Ca2+ signals (reflected as abnormal sensor readouts) and neurite outgrowth (2). The new GCaMP-X sensors are designed with apoCaM protection and explicit localization (e.g., GCaMP-XC for cytosolic Ca2+) to eliminate GCaMP perturbations on CaV1 gating (3) and signaling (4). b Sensor performance of GCaMP-XC validated by single-AP like Ca2+ transients in HEK293 cells. Briefly, glass electrodes formed the Giga-Ohm seal with cell membrane (resting); then 3 ms ZAP for break-in generated a rapid Ca2+ influx due to transient membrane rupture, immediately followed by a fast decay arising from strong Ca2+ chelators of 10 mM BAPTA included in the pipette solution. Key indices of peak ΔF/F0, rise time tr, decay time td and SNR were compared between GCaMP6m and GCaMP6m-XC. Epi-fluorescence images were acquired at the sampling rate of 100 Hz or higher. ce Sensor performance of GCaMP-XC validated with mechanosensing outer hair cells. Cells were transfected with GCaMP6m or GCaMP6m-XC at P1 by electroporation, and cultured for 1 day (DIV 1) or 3 days (DIV 3). Fluid-jet pulses of 100, 300 or 500 ms were applied to cells (c). Representative images, normalized fluorescence changes (ΔF/F0) indicative of Ca2+ dynamics and statistical summary of peak ΔF/F 0 were compared between DIV 1 (d) and DIV 3 (e) cells expressing GCaMP6m or GCaM6m-XC. Standard error of the mean (S.E.M.) and Student’s t-test (two-tailed unpaired with criteria of significance: *p < 0.05; **p < 0.01, and ***p < 0.001) were calculated when applicable, and n.s. denotes “not significant”

Sensor performance of GCaMP-XC is comparable to GCaMP

GCaMP-X does not introduce any de novo mutations on the part of GCaMP and CBM would not interfere with Ca2+/CaM binding of M13 within GCaMP, thus unlikely to affect its performance as Ca2+ sensors. Due to GCaMP perturbations on E–T coupling in excitable cells (which cause Ca2+ distortion in the first place), instead of native neurons, HEK293 cells in response to 10 μM acetylcholine (Ach)5 were used as the cellular context to fairly compare basic sensor characteristics such as Ca2+ sensitivities, which turned out to be indistinguishable between GCaMP and GCaMP-XC (Supplementary Fig. 11a). To closely examine the kinetics, the approach we employed was to induce Ca2+ dynamics mimicking that of one single action potential (AP), by fast break-in with brief ZAP stimulus, aided with strong Ca2+ chelators of 10 mM BAPTA in patch-recording pipettes. This way, a Ca2+ transient was created with fast onset and offset. GCaMP6m and GCaMP6m-XC resulted into indistinguishable characteristics of peak ΔF/F0, SNR, rise time tr and decay time td (Fig. 6b). Their t r values were about the same (~0.1 s), further confirmed by an alternative approach to induce faster (t r  < 0.1 s) Ca2+ influx via voltage-gated CaV2.2 channels (Supplementary Fig. 12), which are similar to the measurements from single AP-driven Ca2+ in neurons7. Their comparable sensor performances suggest that Ca2+-dependent conformational changes within GCaMP-X should have no major difference from conventional GCaMP.

In addition, for outer hair cells expressing GCaMP6m or GCaMP6m-XC (by electroporation), Ca2+ fluorescence indicative of mechanosensitive currents further confirmed that GCaMP-X design would not perturb Ca2+ sensing mechanisms within GCaMP. Upon mechanical stimuli of fluid jet with different durations (100 ms, 300 ms or 500 ms)39 (Fig. 6c), freshly-prepared tissue and cells (DIV 1) exhibited similar stimulus-dependent fluorescence signals (ΔF/F 0 ) for both sensors (Fig. 6d). However, for a loner time of tissue culture (DIV 3), during which the side-effects of GCaMP6m (e.g., by interfering with CaV1.3 in hair cells) would emerge, manifested as weaker Ca2+ responses as compared with cells expressing GCaMP6m-XC, supporting that GCaMP6m caused the attenuation of Ca2+ signals while GCaMP6m-XC avoided the problem (Fig. 6e).

Therefore, GCaMP-X inherits the excellent properties of Ca2+ sensing evolved from generations of GCaMP, while avoiding Ca2+ distortion and other problems. Documented problems of GCaMP in Ca2+ sensing, such as weak or diminished readout of Ca2+ signal, are likely due to E–T perturbations and CaV1 dysregulations in excitable cells.

GCaMP-XN as a novel type of nuclear Ca2+ sensors

Nuclear Ca2+ plays vital roles in the nervous system34, the heart40, and immune cells41. In neurons, nuclear Ca2+ could act as the controlling factor over transcription signaling and gene expression. Organic fluorescent dyes such as Fura-2 may help explore Ca2+ dynamics in the nuclear42. However, for GECIs, due to aforementioned side-effects and mechanisms, serious concerns have been raised regarding whether CaM-based GECIs including GCaMP can serve as safe and trustworthy probes when present in nuclei. These effects sometimes were apparent since nuclear-filled GCaMP seemed to end up with distorted and attenuated fluorescence, indicative of dysregulated Ca2+ dynamics5 due to cell damages. In some other cases, such side-effects of nuclear GCaMP might be less noticeable, e.g., effects of NLS-GCaMP-NLS earlier before any apparent damage to the cell, because the interference with E–T signaling should be always present in principle and also takes time to manifest (Figs. 1h3c and Supplementary Fig. 6c).

Greatly encouraged by GCaMP-X prototypes which successfully eliminate deleterious side-effects, we proceeded to design a new type of GCaMP-XN targeting genuine and intact nuclear Ca2+ without aforementioned perturbations (Fig. 7a). GCaMP-XN is based on GCaMP-X but with NLS (nuclear localization signal) motif fused onto the C-terminus. We first validated GCaMP-XN by examining and comparing pCREB signals and neurite outgrowth in cortical neurons transfected with NLS-GCaMP3-NLS vs. GCaMP3-XN. Neurons expressing GCaMP3-XN exhibited similar levels of pCREB and neurite outgrowth as the control neurons, whereas NLS-GCaMP3-NLS exhibited strong pCREB inhibition and caused neurite damages (Fig. 7b, c), demonstrating the advantages of GCaMP-XN over conventional GCaMP as sensors of nuclear Ca2+. In cortical neurons stimulated by 40 mM [K+]o, GCaMP3-XN with confocal fluorescence imaging resulted into more pronounced (larger peak of ΔF/F0) and faster (8-fold rising speed in ΔF/F0 · s−1) Ca2+ dynamics than NLS-GCaMP3-NLS (Fig. 7d). In line with prior reports, high correlations existed between cytosolic (by GCaMP-XC) and nuclear Ca2+ signals (by either GCaMP-XN or NLS-GCaMP-NLS) (Fig. 7e, f). For neurons expressing GCaMP-XN, GCaMP-XC or GCaMP (nuclear-filled or nuclear-excluded), the comparison among their Ca2+ responses suggest that GCaMP-XC and GCaMP-XN should provide most reliable measurements, while GCaMP distorted Ca2+ signals in dual directions, corresponding to attenuated or enhanced CaV1 and E–T coupling in nuclear-filled or nuclear-excluded neurons respectively (Supplementary Fig. 13). All these data suggest that the discrepancy between the new GCaMP-XN and conventional nucleus-localized GCaMP should be mainly due to systematic dysregulations of Ca2+ dynamics and signaling rather than intrinsic sensing capabilities of the probes. We provided further evidence with HEK293 cells which do not have the neural mechanisms of CaV1-dependent E–T coupling. In HEK293 cells responding to Ach stimulation, similar cytosolic Ca2+ signals were measured by GCaMP-XC and GCaMP; and GCaMP-XN and NLS-GCaMP-NLS resulted into comparable readouts of nuclear Ca2+ (Supplementary Fig. 11b).

Fig. 7
figure7

Characterizations and validations of GCaMP-XN targeting nuclear Ca2+. a Design of GCaMP-XN. Based on the design principle of GCaMP-X, similar to GCaMP-XC, CBM was fused into N-terminus of GCaMP; and a nuclear localization signal (NLS) was tagged onto C-terminus of GCaMP. b, c Basic validations of GCaMP3-XN with pCREB signals and neurite outgrowth. Representative images of pCREB immunostaining (b, left), statistical summary of pCREB intensities (b, right), tracing of neurite morphology (c, upper), Sholl analysis and statistical summary of neurite length (c, lower) were compared among neurons transfected with YFP, NLS-GCaMP3-NLS or GCaMP3-XN. d Different Ca2+ dynamics resulted from neurons expressing NLS-GCaMP3-NLS or GCaMP3-XN. Confocal images representing Ca2+ fluorescence at three phases: before, during and at the end of extracellular stimuli of 40 mM [K+]o (upper). Ca2+ response (ΔF/F0) (lower left) and its rising speed (ΔF/F0·s−1, normalized change of fluorescence per second, lower right) were averaged from multiple neurons (number indicated within parentheses), to compare NLS-GCaMP3-NLS with GCaMP3-XN. e, f Simultaneous monitoring of cytosolic and nuclear Ca2+ dynamics. Representative confocal images indicative of Ca2+ fluorescence (upper in green) and time-dependent responses (ΔF/F0, lower) are to compare Ca2+ dynamics in the cytosol vs. the nucleus of the same neuron upon 40 mM [K+]o stimuli. Cytosolic Ca2+ was monitored by GCaMP3-XC for both cases, whereas nuclear Ca2+ was either by GCaMP3-XN (e) or by NLS-GCaMP3-NLS (f). Neurons were loaded with Hoechst 33342 to label the nuclei of neurons (upper, blue). Standard error of the mean (S.E.M.) and Student’s t-test (two-tailed unpaired with criteria of significance: *p < 0.05; **p < 0.01, and ***p < 0.001) were calculated when applicable, and n.s. denotes “not significant”

Discussion

In this work, we conducted in-depth analyses on the mechanisms of the “side-effects” existing to widely-applied GCaMP sensors in Ca2+ fluorescence imaging. Data unveiled that GCaMP interferes with CaV1/CaM-mediated excitation–transcription coupling in neurons. With these novel insights, we then developed new GCaMP-X sensors immune to side-effects for faithful monitoring of Ca2+ dynamics in cells including specific subcellular compartments, e.g., cytosol (GCaMP-XC) or nucleus (GCaMP-XN) or plasma membrane (GCaMP-XM). The key is to supply GCaMP with an extra motif of high-affinity apoCaM-binding, which eliminates GCaMP perturbations on apoCaM and its subsequent Ca2+/CaM signaling endogenous to the native cell or particularly its CaV1 channels. This way, GCaMP-X sensors resolved all the problems of GCaMP, while still inheriting its excellent sensing capabilities in monitoring Ca2+ dynamics.

CaM has been encoded into various CaM-based GECIs, with GCaMP as the representative. Vast efforts were put into updating GCaMP generation by generation through screening thousands of structure-based or random mutagenesis to improve baseline fluorescence, photostability, dynamic range, and Ca2+ affinity5,6,7,43. However, until this work the major drawback of GCaMP has not yet been specifically addressed and resolved, such as the well-known nuclear accumulation and related cell damages. We went beyond simply attributing these side-effects to over-buffering which supposedly could happen to almost any probes of excessive amount15,16, unveiling that the true mechanisms underlying GCaMP effects are due to its CaM motif, which interferes with CaV1-dependent E–T coupling thus damaging neurons (Figs. 13 and Fig. 6a).

Meanwhile, side-effects of another kind, although less obvious, could significantly alter intrinsic Ca2+ dynamics and membrane excitability (Fig. 4, Fig. 6e and Fig. 7f) as well as cellular signaling (Fig. 3), which could well explain similar observations from neurons and myocytes4,9,13,14,44. Nevertheless, perturbations of this kind have not been widely reported thus far, probably due to the following reasons. First, effects of neural damage and cell death are more apparent and problematic than other less discernible phenotypes such as CaV1 upregulations. Second, the basal fluorescence of Ca2+-free GCaMP is far less bright than GFP or Ca2+/GCaMP. Thus, relying on the basal GCaMP fluorescence, the neurons categorized as “low expression” may still have substantial levels of GCaMP generating the phenotypes of CaV1 upregulation; meanwhile, GCaMP below this threshold level would be overlooked in the experiments due to “no expression”.

Our discovery of CaV1/GCaMP interplays essentially provides the mechanistic linkage to the well-known (damages of cell health) and less-noticeable (alterations of cell functions) drawbacks of CaM-based GECIs. Based on the phenotypical correlation between neural damages and GCaMP levels, existing efforts tried to gauge GCaMP expression with different strategies, e.g., to select relatively weak promotors trying to alleviate the side-effects. Abnormalities in E–T coupling in GCaMP-expressing neurons should happen earlier than the clear sign of nuclear GCaMP accumulation and neural damages (Supplementary Fig. 6d). Moreover, GCaMP-X without any localization signal, even with high expression levels, no longer accumulated in the nucleus to perturb pCREB signals (Fig. 5a, b), suggesting apoCaM protection is an effective way to alleviate nuclear filling. Considering the direct effects of cytosolic and nuclear GCaMP, it is likely that multiple CaM/GCaMP-dependent processes are involved in aberrant nuclear invasion and subsequent cell damages. When these processes were not present or less dominant, e.g., in HEK cells lacking native E–T coupling, no difference between GCaMP and GCaMP-X was found (Supplementary Fig. 11), distinct from neurons (Fig. 7).

Some current lines of transgenic mice using weaker promoters suffer from low expression levels, limiting their usage due to poor SNR16. GCaMP6 mice should be much improved in that the sensing performance is excellent while exhibiting no sign of nucleus filling as claimed45. However, GCaMP present in the cytosol is still problematic by acting on CaV1. In comparison with viral infection, nucleus-filling neurons from GCaMP6 transgenic mice are much less, but still discernible46; and nuclear GCaMP of even lesser amount is still able to intervene gene transcription in principle. Evidently, GCaMP affected neural excitability in GCaMP5G or GCaMP6 transgenic mice13,14. Although no difference in LTP was detected with or without GCaMP3 in CA1 hippocampal neurons47, further thorough analyses of synaptic plasticity are necessary because subtle but confirmative effects on E–T coupling by GCaMP could vary, depending on particular brain regions, cell types, expression levels and experimental settings.

Non-CaM based sensors, such as the troponin-based TN-XL series48, are unlikely to suffer from the side-effects associated with GCaMP or aberrant CaM. Meanwhile, many CaM-based GECIs have been developed and still currently used, such as GCaMP6f/m/s and GCaMP variants of other colors (e.g., RCaMP), cameleons (FRET-based GECI), D3cpv and Camgaroos (improved versions of cameleons), CaMPARI (a newly reported GECI of Calcium Modulated Photoactivatable Ratiometric Integrator), inverse pericam (fluorescence inversely correlating with Ca2+) and so on6,7,49,50,51,52,53,54. As proved with some of these GECIs, E–T coupling would be similarly perturbed by the CaM domain of the above sensors through apoCaM and/or Ca2+/CaM effects, leading to functional and/or morphological defects in cells. It is implied that the design principles should be even more broadly applicable beyond GCaMP-X, serving not only as the key amendment for existing sensors, but also one prerequisite to design any future CaM-based tools. We further speculate that for any exogenous entities containing endogenous proteins (or their key domains), protections should be well planned and implemented to constrict the actions of such factors in cells. Taking GCaMP and GCaMP-X as the example, the apoCaM contained in GCaMP should be under the control of the extra protection motif CBM to prevent the CaM motif from outreaching beyond the sensor. In this context, an alternative approach to design sensors and actuators might be appealing—totally de novo proteins/peptides for the particular cells/tissues/organisms through rational design or from other remote species in the phylogenetic tree. The former exemplars are computation-aided design of new calcium probes55, and the successful cases of the latter are GFP56 and ChR257, originated from ancient organisms jellyfish Aequorea victoria and alga Chlamydomonas reinhardtii respectively.

CaM (apoCaM or Ca2+/CaM) is universally involved in complicated signaling in cells19,58, e.g., CaM overexpression in neurons would severely perturb gene expressions in cortical neurons44. In addition to CaV1, various channels, receptors and enzymes could be perturbed by CaM-based probes59,60,61, involving various physiological processes including membrane excitability, calcium dynamic, long-term potentiation or depression (LTP/LTD), synaptic transmission, CREB-dependent or other transcriptional signaling (MAPK/Erk, NFAT etc.), neural morphogenesis, cell cycles, cardiac hypertrophy and neural degeneration9,62,63,64,65. Can the principles derived from GCaMP-X design assure the exclusion of the above possible perturbations? According to this study, apoCaM interference is eliminated by CBM central to GCaMP-X design, indicative of an effective approach to avoid unwanted binding with apoCaM targets as well as their subsequent Ca2+/CaM binding/signaling. Other apoCaM-associated signaling events, e.g., of enzymes and cytoskeletal proteins, should also be effectively protected by our strategy9. Native protein targets of Ca2+/CaM binding should not be affected by either GCaMP or GCaMP-X, considering that the Ca2+/CaM motif preferentially binds onto the M13 motif within the same sensor because of their intramolecular closeness11 and high affinity (Kd ≈ 4 nM for Ca2+/CaM)37. Therefore, in combination of CBM and M13, spatial restrictions are applied onto the CaM motif under all Ca2+ conditions, thus effectively reducing its overall mobility and concentration. Both apo and Ca2+ forms of CaM or GCaMP-X are protected, greatly enhancing its resistance against any potential intermolecular binding with endogenous signaling proteins.

Due to compartmentalized nature of cellular calcium, a variety of organelle-targeted GECIs are developed, e.g., to address the questions specifically for nuclear calcium34. Nuclear presence of GCaMP has been considered as a sign of cell damages5,7, also confirmed in this study by nucleus-accumulated GCaMP or by NLS-GCaMP-NLS. However, the reasons for such damages remain unclear. Instead of any direct interference with Ca2+/CaM-binding proteins, it is more likely that GCaMP struck in the nucleus impairs certain critical apoCaM-related nuclear signaling thus eventually causing neural damages. Meanwhile, the reason of nuclear invasion and aberrant accumulation has not been elucidated either. It is unlikely due to proteolytic cleavage as proposed2, because nuclear GCaMP, although its readout was indeed attenuated, should mainly arise from neural damages and Ca2+ distortion instead of any alteration in sensor functionalities (Fig. 7 and Supplementary Fig. 11). Generally, the size and shape of proteins may play a role in the passive entrance to the nucleus. However, based on the estimation and measurement, the slight difference in molecular weight between GCaMP (~50 kDa)66 vs. GCaMP-X (~54 kDa) cannot account for their distinct cytonuclear localization. Also, according to the design of GCaMP-X and our homology modeling to compare their (apo) structures, the CBM binding to CaM constricts the freedom of the whole CaMP structure, making it less stretched out. Collectively, in this particular case of GCaMP-X vs. GCaMP, the size and shape are less likely to play any major roles. In addition, D3cpv has higher molecular weight (~73 kDa), which is also a FRET sensor presumably in more “extended” shape, but still producing severe side-effects while getting accumulated in the nucleus (~40% with the criteria of N/C ratio above 1, Supplementary Fig. 10). Based on these data and facts, we speculate that the nuclear accumulation of GCaMP might be caused by certain mechanisms related to activity-dependent or calcium-dependent cytonuclear translocation of CaM. Therefore, the bottom line is that GCaMP exerts its dominant negative effects through its CaM motif with incomplete and abnormal functionalities. As the roles and mechanisms related to nuclear Ca2+ are not fully understood thus far, we expect GCaMP-XN to facilitate the progress of research in this direction, including the following key questions: what is the exact spatiotemporal relationship between nuclear and transmembrane Ca2+, and how exactly the information of activities is encoded into nuclear Ca2+ and other related signals.

Based on above analyses, it is fairly possible that no or trivial effect could be induced when the actual expression level of GCaMP is extremely low (even lower than the fluorescence threshold in our imaging experiments). This is probably the case in some lines of GCaMP transgenic mice where no appreciable perturbation would be induced. In fact, much lower concentration of GCaMP has been reported in transgenic mice, e.g., GCaMP3/Ai38 mice (~5 μM), compared to tens of μM or even higher GCaMP concentrations in viral infection16. In this context, we would not disagree with the claim from the researchers who routinely use GCaMP transgenic mice that these mice seem healthy and normal in general. Meanwhile, due to the above concerns we would like to suggest that cautions need to be taken when using the current lines of GCaMP transgenic mice, especially when suspicious complications were encountered, such as the epileptiform events from multiple GCaMP6 lines14. And GCaMP-X promises one direct solution with multi-fold advantages over conventional GCaMP. For instance, the low expression level required by GCaMP (to reduce severity of side-effects) constitutes one major drawback (low SNR due to insufficient GCaMP expression), potentially overcome by GCaMP-X with strong promoters to elevate expression and SNR in future lines.

As learned from this study, for any GECI, thorough tests should be carefully performed under various conditions beyond sensing characteristics. For GCaMP-X, it is imperative to validate its actual performance in vivo, especially for the goals of generating transgenic organisms. GCaMP-X would bring advantages of multi-fold to the new transgenic lines: free of complications and side-effects, allowing high expression levels, as well as excellent sensor characteristics including rapid kinetics and high SNR. Meanwhile, further optimization and more variants of GCaMP-X are expected, based on fast-growing structural and functional insights into GCaMP/CaM and related interactions of both apo and Ca2+ forms, to fulfill diverse and specific demands toward more precise and thorough information of cell Ca2+.

Methods

Molecular biology

CaV1.3 α1D_Long (denoted as α1DL) variant (NM000720, GenBankTM accession number), CaV2.2 (α1B, NM_001243812.1), CaM and CaM1234 were generously provided by Dr. David Yue (Johns Hopkins University). cDNA constructs of certain GCaMP variants were generous gifts from Drs. Minmin Luo and Sen Song (Tsinghua University). cDNA constructs encoding D3cpv (36323) and CaMPARI (60421) were purchased from Addgene. Inverse pericam was provided by Dr. Atsushi Miyawaki (Riken Brain Science Institute). CaV1.3 α1D_Short (denoted as α1DS) variant was constructed by introducing a unique XbaI site following the IQ domain. YFP-tagged CaM/pcDNA3 was firstly generated by inserting YFP into pcDNA3 vector via unique KpnI and NotI sites, then CaM was fused to carboxyl termini of YFP via unique NotI and KpnI sites22. To target CFP and GCaMP3 to the nucleus of cells, a short NLS (PKKKRKV) was fused to both amino and carboxyl termini. NLS-CFP-NLS segment was amplified by PCR with flanking KpnI and XbaI then cloned directionally via these two unique sites into pcDNA3 expressing plasmids. NLS-GCaMP3-NLS segment was amplified by PCR with flanking BglII and NotI then cloned by replacing GCaMP3 via these two unique sites, yielding NLS-GCaMP3-NLS. IQ domain from neuromodulin (NM_017195.3) with modifications to render constitutive high-affinity apoCaM binding was amplified by PCR, with the sequence encoding MGMDELYKGTAATKIQAAFRGHITRKKLKDEKKGA (denoted as CBM). The fusion of CBM-GCaMP3 (GCaMP3-XO) was ligated with EcoRI by overlap PCR with flanking BglII and NotI then cloned into pEGFP-N1 vector. CBM-GCaMP5G (GCaMP5G-XO) and CBM-GCaMP6m (GCaMP6m-XO) constructs were made by replacing GCaMP3 with appropriate PCR-amplified segments via unique EcoRI and NotI sites. To cytosolic localizations, NES (LALKLAGLDIGS) was fused to carboxyl terminus of GCaMP-XO. Construct of CBM-GCaMP3-NES, CBM-GCaMP5G-NES and CBM-GCaMP6m-NES were named GCaMP3-XC, GCaMP5G-XC and GCaMP6m-XC, respectively. To specifically target the nucleus, NLS (PKKKRKV) was fused to its C-terminus of GCaMP-XO. Construct of CBM-GCaMP3-NLS was named as GCaMP3-XN. To target the membrane, Lck sequence of MGCGCSSNPEDDWMENIDVCENCHYPPPKLRIDPPDLAT was fused to the N-terminus of the sensors, then cloned into pcDNA3 vector via unique BamHI and NotI sites. The membrane-targeted versions of GCaMP3 and GCaMP3-X were denoted as GCaMP3M and GCaMP3-XM, respectively.

TagRFP was amplified by PCR with flanking KpnI and NotI and cloned directionally via these two unique sites into pcDNA3 expressing plasmids. Then GCaMP3 was amplified with flanking NotI and XbaI and cloned via these two sites into pcDNA3, yielding TagRFP-GCaMP3 construct. To make GCaM1234P3 construct, CaM1234 was amplified by overlap PCR with point mutation N60D and flanking MluI and NotI then cloned by replacing CaM N60D within GCaMP3. To delete M13 and cpEGFP from GCaMP3 and GCaM1234P3, EGFP was amplified by PCR with flanking BglII and MluI then cloned by replacing M13 and cpEGFP via these two unique sites based on GCaMP3 and GCaM1234P3, respectively. For chimeric α1DS-DCTF, α1DS -G12-GCaMP3 and α1DS -G12-GCaMP3ΔM13-cpEGFP, α1DS-DCTF was adopted from our previous work22,67. G12 segment was PCR-amplified with SpeI and XbaI sites and inserted into α1DS as template. GCaMP3 and GCaMP3ΔM13-cpEGFP then were PCR-amplified with identical SpeI and XbaI sites and inserted into α1DS -G12.

Dissection and culturing of cortical neurons

Cortical neurons were dissected from newborn ICR mice. Isolated tissues were digested with 0.25% trypsin for 15 min at 37 °C, followed by terminating the enzymatic reaction by DMEM supplemented with 10% FBS. The suspension of cells was sieved through a filter then centrifuged at 1000 rpm for 5 min. The cell pellet was resuspended in DMEM supplemented with 10% FBS and were plated on poly-D-lysine-coated 35 mm confocal dishes (In Vitro Scientific) or coverslips. After 4 h, neurons were maintained in Neurobasal medium supplemented with 2% B27, 1% glutaMAX-I (growth medium) for 5–6 days. Temperature should be around 37 °C with 5% CO2 in the incubator. All animals were obtained from the laboratory animal research center, Tsinghua University. Procedures involving animals has been approved by local institutional ethical committees (IACUC, Tsinghua University).

Transfection of cDNA constructs

The HEK293 cell line (ATCC) used in this study was free of mycoplasma contamination, checked by PCR with primers 5′-GGCGAATGGGTGAGTAACACG-3′ and 5′-CGGATAACGCTTGCGACCTATG -3′22. HEK293 cells were cultured in 60 mm dishes, and recombinant channels were transiently transfected according to an established calcium phosphate protocol22. We applied 5 μg of cDNA encoding the desired channel α1 subunit, along with 4 μg of rat brain β2a (M80545) and 4 μg of rat brain α2δ (NM012919.2) subunits. Additional 2 μg of cDNA was added as required in co-transfections. All of the above cDNA constructs were driven by a cytomegalovirus promoter. To enhance expression, cDNA for simian virus 40 T antigen (1–2 μg) was also co-transfected. Cells were washed with PBS 6–8 h after transfection and maintained in culture medium of supplemented DMEM, then incubated for at least 48 h in a water-saturated 5% CO2 incubator at 37 °C before whole-cell recordings.

Neurons were cultured in 35 mm confocal dishes or coverslips, 2 μg of cDNA encoding the desired peptides were transiently transfected by Lipofectamine 2000 (Invitrogen). The opti-MEM containing plasmids and Lipofectamine 2000 was added to the Neurobasal medium for transfection. After 2 h, neurons were maintained in Neurobasal medium supplemented with 2% B27, 1% glutaMAX-I for 48 h.

Infection of adeno-associated virus

Virus of GCaMP6m (AAV-Syn-GCaMP6m), GCaMP6f (AAV-Syn-GCaMP6f) and GCaMP6m-XC (AAV-Syn-GCaMP6m-XC) were provided by University of Pennsylvania Vector Core (USA) or Hanbio Biotechnology (China). Viruses were added to growth medium of the cortical neuron culture for 1–2 weeks.

Whole-cell electrophysiology

Whole-cell recordings of transfected HEK293 cells or cortical neurons were obtained at room temperature (25 °C) using an Axopatch 200B amplifier (Axon Instruments). Electrodes were pulled with borosilicate glass capillaries by a programmable puller (P-1000, Sutter Instruments) and heat-polished by a microforge (MF-830, Narishige), resulting in 1–3 MΩ resistances, before series resistance compensation of 70% or more. The internal solutions contained, (in mM): CsMeSO3, 135; CsCl2, 5; MgCl2, 1; MgATP, 4; HEPES, 5; and EGTA, 5; at 290 mOsm adjusted with glucose and at pH 7.3 adjusted with CsOH. The extracellular solution contained (in mM): TEA-MeSO3, 140; HEPES, 10; CaCl2 or BaCl2, 10; 300 mOsm, adjusted with glucose and at pH 7.3 adjusted with TEAOH, all according to the previous reports22,67. Whole-cell currents were generated from a family of step depolarizations (−70 to + 50 mV from a holding potential of −70 mV) or a series of repeated step depolarizations (−10 mV from a holding potential of −70 mV). Currents were recorded at 2 kHz by the low-pass filter, and cells with Ca2+ current amplitude less than 100 pA were not included in the analyses. Traces were acquired at a minimum repetition interval of 30 s. P/8 leak subtraction was used throughout.

For patch-clamp recordings on neurons, isolated cortical neurons were cultured for 11 days in order to obtain larger calcium current. To isolate CaV1.3 currents, CaV1.2, N- and P/Q-type Ca2+ channel currents were blocked by pre-incubating neurons in Tyrode’s solution containing 1 μM nimodipine (Sigma-Aldrich), 1 μM ω-conotoxin GVIA (Sigma-Aldrich, or Alomone Labs), 1 μM ω-conotoxin MVIIC (Sigma-Aldrich, or Alomone Labs) for 30 min before recording, according to cocktail recipes65,68,69, validated with our recordings in which CaV1.3 was the dominant component (~80%), compared to CaV2.3 (~16%) and CaV1.2 (contributing to the rest). Neurons were used within 1 h after pre-incubation and recorded in bath solution with blocker cocktail.

In all electrophysiological experiments, recordings from at least four cells were analyzed (n ≥ 4).

Immunocytochemistry

Cortical neurons which were transfected on 5th day and used on 7th day, were silenced with 1 μM TTX for 24 h to prevent AP, then transferred to 40 mM [K+]o solution (1 μM TTX, 95 mM NaCl, 40 mM KCl, 1 mM MgCl2, 15 mM HEPES, 1.2 mM CaCl2, at 300 mOsm adjusted with glucose) or 20 mM [K+]o solution (1 μM TTX, 115 mM NaCl, 20 mM KCl, 1 mM MgCl2, 15 mM HEPES, 1.2 mM CaCl2, at 300 mOsm adjusted with glucose) and treated for 30 min (detecting pCREB) or 5 min (detecting CaM). Then cortical neurons were rinsed briefly in phosphate-buffered saline (PBS), fixed with ice cold 4% paraformaldehyde in PBS (pH 7.4) for 20 min at the room temperature (~25 °C), then washed three times with ice-cold PBS. Fixed cells were then permeabilized with 0.3% Triton X-100 and blocked with 10% normal goat serum in PBS for 1 h at room temperature, and incubated overnight at 4 °C in primary antibodies of pCREB (Rabbit mAb #9198, Cell Signaling Technology, Species Cross-Reactivity: Human, Mouse, Rat, Dilutions: 1:1000), CREB (Rabbit mAb #9197, Cell Signaling Technology, Species Cross-Reactivity: Human, Mouse, Rat, Monkey, D. melanogaster, Dilutions: 1:500) or CaM (Rabbit mAb #5197-1, Epitomics, Species Cross-Reactivity: Human, Mouse, Rat, Dilutions: 1:500). The next day, cells were washed with PBS three times, incubated at room temperature for 2 h in 1:800 dilution of anti-rabbit-Alexa633 (Invitrogen), and washed with PBS three times (incubated with Hoechst 33342 for 5 min when nuclear counterstain was needed). Cells were imaged with ZEISS Laser Scanning Confocal Microscope (LSM710) (Carl Zeiss) and ZEN 2009 software. Fluorescence intensity was quantified and analyzed with ImageJ (NIH). Calculations of nuclear fluorescence intensity were aided with nuclear regions stained by Hoechst 33342. In all immunocytochemistry experiments, images of at least ten cells were analyzed (n ≥ 10).

Apoptosis assay

Cortical neurons on confocal dishes were incubated with fluorescein-labelled Annexin V reagent (Keygen Biotech, 1:100 dilution) for 15 min at the room temperature (~25 °C). Cells were washed once with Tyrode’s solution and observed with a confocal laser microscope (LSM710).

Fluorescence Ca2+ imaging with GCaMP or GCaMP-X

Cortical neurons were pre-incubated in 5 mM [K+]o solution (130 mM NaCl, 5 mM KCl, 1 mM MgCl2, 15 mM HEPES, 2 mM CaCl2, at 300 mOsm adjusted with glucose) and perfused with 20 or 40 mM [K+]o solution, then washed out by 5 mM [K+]o. Epi-fluorescent imaging experiments were performed with an inverted fluorescence microscope (Ti-U, Nikon, Japan) and Neo sCMOS camera (Andor Technology). The light source was from the mercury lamp filtered at appropriate wavelengths for GFP by the optical filters mounted at the computer-controlled filter wheel (Sutter Instrument) for excitation, subsequently passing the dichroic mirror and the emission filters. Operations and measurements were controlled by the iQ software (Andor Technology). For confocal Ca2+ imaging, a similar protocol was followed with ZEISS Laser Scanning Confocal Microscope (LSM710) (Carl Zeiss) and ZEN 2009 software. Fluorescence intensity (F) was subtracted from its background, to calculate the index of ΔF/F0, where F0 is the baseline fluorescence averaged from 1 s or three or more data points at rest, and ΔF = F−F0.

Fluorescence Ca2+ imaging with Fura-2

Cortical neurons were cultured on coverslips and were loaded in Tyrode’s solution with 5 μM Fura-2 AM (Abcam) and 0.02% Pluronic F-127 (Invitrogen) in incubator for 30 min. Neurons were pre-incubated in 5 mM [K+]o solution and perfused with high [K+]o solution, then washed out by 5 mM [K+]o. Fluorescence ratio (F340/F380) was achieved with a standard ratiometric Ca2+ imaging system, which included an inverted IX71epi-fluorescence microscope (Olympus), a camera of EMCCD DU-897D (Andor Technology), the light source of Lambda DG-4 (Sutter instrument), the excitation filters of 340 nm and 380 nm: FF01-340/26-25 (Semrock) and FF01-380/14-25 (Semrock), the emission filters of ~510 nm: FF01-504/12-25 (Semrock), and the dichromatic mirror: DM 400 in U-MWU2 cube (Olympus). Images were acquired and analyzed by MetaFluor software (Molecular Devices).

Induction of Ca2+ dynamics in HEK293 cells

To generate Ca2+ waveforms resembling that of single AP, the glass electrode for whole-cell patch clamp was filled with the intracellular solution containing strong Ca2+ chelators of 10 mM BATPA. Subsequent to the standard GΩ-seal formation, 3 ms ZAP stimulation from the amplifier (Axopatch 200B) was applied for membrane break-in. Due to transient membrane rupture, a rapid Ca2+ influx was induced (to mimic the rising phase of AP-associated Ca2+). Immediately after, whole-cell configuration was stably established, and BAPTA quickly diffused into the cell, which altogether attenuated intracellular Ca2+ (mimicking the decay phase of single-AP Ca2+ waveform). An alternative approach to produce rapid Ca2+ influx was by way of voltage-gated CaV2.2 channels overexpressed in HEK293 cells (CaV2.2 current amplitudes were within the range of 0.5–2 nA). A 100 ms of +10 mV voltage step was applied to depolarize the membrane and activate CaV2.2 channels. Under this approach, Ca2+ influx was more controllable since CaV2.2 currents (ICa) were simultaneously monitored by whole-cell patch clamp while GCaMP fluorescence images were acquired at 100 Hz or higher. Another simple method was also used to generate Ca2+ dynamics by acetylcholine (Ach) activation of endogenous muscarinic receptors in HEK293 cells5. Bath containing 10 μM Ach (TargetMol) was briefly applied to cells and then washed out. Rise time tr was defined as the time (from the start of stimulation) to reach the half of peak ΔF/F0. Decay time td was defined as the time (from the time of peak) to fall back to the half of peak ΔF/F0. SNR was calculated by the ratio of peak ΔF/F0 over standard derivation (SD) of baseline signals (1 s duration).

Ca2+ imaging with outer hair cells

According to previously published protocol39, the organ of Corti containing outer hair cells was isolated from P1 mice. For electroporation, glass electrodes (2 μM diameter) were used to deliver plasmids (1 μg/μl in 1 × HBSS) to outer hair cells. A series of three pulses was applied at 1 s intervals with a magnitude of 60 V and duration of 15 ms (ECM 830 square wave electroporator, BTX). Organ was cultured for 1–3 days in DMEM/F12 medium with 10% FBS and 1.5 μg/ml ampicillins. For Ca2+ imaging, outer hair cells were imaged on an upright Olympus BX51WI microscope. Hair bundles of outer hair cells were stimulated with a fluid jet applied through a glass electrode filled with bath solution (1.3 mM CaCl2, 144 mM NaCl, 0.7 mM NaH2PO4, 5.8 mM KCl, 0.9 mM MgCl2, 5.6 mM glucose, and 10 mM H-HEPES, pH 7.4). Stimuli were controlled by Patchmaster 2.35 software (HEKA) and 20 psi air pressure were applied for each stimulation. Sampling rate of images was at 2 s, and duration of fluid-jet stimulation was increased from 100 to 300 ms, and then to 500 ms.

Image analysis of neurite morphology

Measurement of the length and Sholl analysis for neurites were performed with Imaris 7.7.2 (Bitplane). Only non-overlapping neurons were selected for analysis and images of at least 14 neurons were analyzed (n ≥ 14).

Data analysis and statistics

Data were analyzed in Matlab, GraphPad Prism and OriginPro software. Standard error of the mean (S.E.M.) and Student’s t-test (two-tailed with criteria of significance: *p < 0.05; **p < 0.01, and ***p < 0.001) were calculated when applicable, and n.s. denotes “not significant”.

Data availability

The authors declare that all data supporting the findings of this study are available within this article and the Supplementary Information File; or available from the corresponding author upon request.

References

  1. 1.

    Berridge, M. J., Bootman, M. D. & Roderick, H. L. Calcium: calcium signalling: dynamics, homeostasis and remodelling. Nat. Rev. Mol. Cell. Biol. 4, 517–529 (2003).

    CAS  Article  PubMed  Google Scholar 

  2. 2.

    Tian, L., Hires, S. A. & Looger, L. L. Imaging neuronal activity with genetically encoded calcium indicators. Cold Spring Harb. Protoc. 2012, 647–656 (2012).

    Article  PubMed  Google Scholar 

  3. 3.

    Nakai, J., Ohkura, M. & Imoto, K. A high signal-to-noise Ca2+ probe composed of a single green fluorescent protein. Nat. Biotechnol. 19, 137–141 (2001).

    CAS  Article  PubMed  Google Scholar 

  4. 4.

    Tallini, Y. N. et al. Imaging cellular signals in the heart in vivo: Cardiac expression of the high-signal Ca2+ indicator GCaMP2. Proc. Natl Acad. Sci. 103, 4753–4758 (2006).

    ADS  CAS  Article  PubMed  PubMed Central  Google Scholar 

  5. 5.

    Tian, L. et al. Imaging neural activity in worms, flies and mice with improved GCaMP calcium indicators. Nat. Methods 6, 875–881 (2009).

    CAS  Article  PubMed  PubMed Central  Google Scholar 

  6. 6.

    Akerboom, J. et al. Optimization of a GCaMP calcium indicator for neural activity imaging. J. Neurosci. 32, 13819–13840 (2012).

    CAS  Article  PubMed  PubMed Central  Google Scholar 

  7. 7.

    Chen, T.-W. et al. Ultrasensitive fluorescent proteins for imaging neuronal activity. Nature 499, 295–300 (2013).

    ADS  CAS  Article  PubMed  PubMed Central  Google Scholar 

  8. 8.

    Barnett, L. M., Hughes, T. E. & Drobizhev, M. Deciphering the molecular mechanism responsible for GCaMP6m’s Ca2+-dependent change in fluorescence. PLoS ONE 12, e0170934 (2017).

    Article  PubMed  PubMed Central  Google Scholar 

  9. 9.

    Colomer, J. M., Terasawa, M. & Means, A. R. Targeted expression of calmodulin increases ventricular cardiomyocyte proliferation and deoxyribonucleic acid synthesis during mouse development. Endocrinology 145, 1356–1366 (2004).

    CAS  Article  PubMed  Google Scholar 

  10. 10.

    Resendez, S. L. et al. Visualization of cortical, subcortical and deep brain neural circuit dynamics during naturalistic mammalian behavior with head-mounted microscopes and chronically implanted lenses. Nat. Protoc. 11, 566–597 (2016).

    CAS  Article  PubMed  PubMed Central  Google Scholar 

  11. 11.

    Mank, M. & Griesbeck, O. Genetically encoded calcium indicators. Chem. Rev. 108, 1550–1564 (2008).

    CAS  Article  PubMed  Google Scholar 

  12. 12.

    Dombeck, D. A., Harvey, C. D., Tian, L., Looger, L. L. & Tank, D. W. Functional imaging of hippocampal place cells at cellular resolution during virtual navigation. Nat. Neurosci. 13, 1433–1440 (2010).

    CAS  Article  PubMed  PubMed Central  Google Scholar 

  13. 13.

    Gee, J. M. et al. Imaging activity in neurons and glia with a Polr2a-based and cre-dependent GCaMP5G-IRES-tdTomato reporter mouse. Neuron 83, 1058–1072 (2014).

    CAS  Article  PubMed  PubMed Central  Google Scholar 

  14. 14.

    Steinmetz N. A. et al. Aberrant cortical activity in multiple GCaMP6-expressing transgenic mouse lines. eNeuro 4, ENEURO.0207-0217.2017 (2017).

  15. 15.

    Helmchen, F., Imoto, K. & Sakmann, B. Ca2+ buffering and action potential-evoked Ca2+ signaling in dendrites of pyramidal neurons. Biophys. J. 70, 1069–1081 (1996).

    ADS  CAS  Article  PubMed  PubMed Central  Google Scholar 

  16. 16.

    Rose, T., Goltstein, P. M., Portugues, R. & Griesbeck, O. Putting a finishing touch on GECIs. Front. Mol. Neurosci. 7, 88 (2014).

    Article  PubMed  PubMed Central  Google Scholar 

  17. 17.

    Hires, S. A., Tian, L. & Looger, L. L. Reporting neural activity with genetically encoded calcium indicators. Brain Cell. Biol. 36, 69–86 (2008).

    CAS  Article  PubMed  PubMed Central  Google Scholar 

  18. 18.

    Hoeflich, K. P. & Ikura, M. Calmodulin in action: diversity in target recognition and activation mechanisms. Cell 108, 739–742 (2002).

    CAS  Article  PubMed  Google Scholar 

  19. 19.

    Cheung, W. Y. Calmodulin plays a pivotal role in cellular regulation. Science 207, 19–27 (1980).

    ADS  CAS  Article  PubMed  Google Scholar 

  20. 20.

    Adams, P. J., Ben-Johny, M., Dick, I. E., Inoue, T. & Yue, D. T. Apocalmodulin itself promotes ion channel opening and Ca(2+) regulation. Cell 159, 608–622 (2014).

    CAS  Article  PubMed  PubMed Central  Google Scholar 

  21. 21.

    Liu, X., Yang, P. S., Yang, W. & Yue, D. T. Enzyme-inhibitor-like tuning of Ca2+ channel connectivity with calmodulin. Nature 463, 968–972 (2010).

    ADS  CAS  Article  PubMed  PubMed Central  Google Scholar 

  22. 22.

    Liu, N. et al. Cooperative and acute inhibition by multiple C-terminal motifs of L-type Ca2+ channels. eLife 6, e21989 (2017).

    PubMed  PubMed Central  Google Scholar 

  23. 23.

    Wheeler Damian, G. et al. CaV1 and CaV2 channels engage distinct modes of Ca2+ signaling to control CREB-dependent gene expression. Cell 149, 1112–1124 (2012).

    CAS  Article  PubMed  PubMed Central  Google Scholar 

  24. 24.

    Ma, H. et al. γCaMKII shuttles Ca2+/CaM to the nucleus to trigger CREB phosphorylation and gene expression. Cell 159, 281–294 (2014).

    CAS  Article  PubMed  PubMed Central  Google Scholar 

  25. 25.

    Zariwala, H. A. et al. A cre-dependent GCaMP3 reporter mouse for neuronal imaging in vivo. J. Neurosci. 32, 3131–3141 (2012).

    CAS  Article  PubMed  PubMed Central  Google Scholar 

  26. 26.

    Heim, N. & Griesbeck, O. Genetically encoded indicators of cellular calcium dynamics based on troponin C and green fluorescent protein. J. Biol. Chem. 279, 14280–14286 (2004).

    CAS  Article  PubMed  Google Scholar 

  27. 27.

    Ben-Johny, M. & Yue, D. T. Calmodulin regulation (calmodulation) of voltage-gated calcium channels. J. Gen. Physiol. 143, 679–692 (2014).

    CAS  Article  PubMed  PubMed Central  Google Scholar 

  28. 28.

    Ma, H., Cohen, S., Li, B. & Tsien, R. W. Exploring the dominant role of Cav1 channels in signalling to the nucleus. Biosci. Rep. 33, 97–101 (2013).

    Google Scholar 

  29. 29.

    Striessnig, J., Pinggera, A., Kaur, G., Bock, G. & Tuluc, P. L-type Ca2+ channels in heart and brain. Wiley Interdiscip. Rev.: Membr. Transp. Signal. 3, 15–38 (2014).

    CAS  Google Scholar 

  30. 30.

    Wong, R. O. L. & Ghosh, A. Activity-dependent regulation of dendritic growth and patterning. Nat. Rev. Neurosci. 3, 803–812 (2002).

    CAS  Article  PubMed  Google Scholar 

  31. 31.

    Krey, J. F. et al. Timothy syndrome is associated with activity-dependent dendritic retraction in rodent and human neurons. Nat. Neurosci. 16, 201–209 (2013).

    CAS  Article  PubMed  PubMed Central  Google Scholar 

  32. 32.

    Singh, A. et al. Modulation of voltage- and Ca2+-dependent gating of CaV1.3 L-type calcium channels by alternative splicing of a C-terminal regulatory domain. J. Biol. Chem. 283, 20733–20744 (2008).

    CAS  Article  PubMed  PubMed Central  Google Scholar 

  33. 33.

    Deisseroth, K., Heist, E. K. & Tsien, R. W. Translocation of calmodulin to the nucleus supports CREB phosphorylation in hippocampal neurons. Nature 392, 198–202 (1998).

    ADS  CAS  Article  PubMed  Google Scholar 

  34. 34.

    Bading, H. Nuclear calcium signalling in the regulation of brain function. Nat. Rev. Neurosci. 14, 593–608 (2013).

    CAS  Article  PubMed  Google Scholar 

  35. 35.

    Chapman, E. R., Au, D., Alexander, K. A., Nicolson, T. A. & Storm, D. R. Characterization of the calmodulin binding domain of neuromodulin. Functional significance serine 41 phenylalanine 42. J. Biol. Chem. 266, 207–213 (1991).

    CAS  PubMed  Google Scholar 

  36. 36.

    Black, D. J., Leonard, J. & Persechini, A. Biphasic Ca2+-dependent switching in a calmodulin-IQ domain complex. Biochemistry 45, 6987–6995 (2006).

    CAS  Article  PubMed  PubMed Central  Google Scholar 

  37. 37.

    Blumenthal, D. K. et al. Identification of the calmodulin-binding domain of skeletal muscle myosin light chain kinase. Proc. Natl Acad. Sci. USA 82, 3187–3191 (1985).

    ADS  CAS  Article  PubMed  PubMed Central  Google Scholar 

  38. 38.

    Shigetomi, E., Kracun, S., Sofroniew, M. V. & Khakh, B. S. A genetically targeted optical sensor to monitor calcium signals in astrocyte processes. Nat. Neurosci. 13, 759–766 (2010).

    CAS  Article  PubMed  PubMed Central  Google Scholar 

  39. 39.

    Xiong, W., Wagner, T., Yan, L., Grillet, N. & Muller, U. Using injectoporation to deliver genes to mechanosensory hair cells. Nat. Protoc. 9, 2438–2449 (2014).

    CAS  Article  PubMed  PubMed Central  Google Scholar 

  40. 40.

    Guatimosim, S. et al. Nuclear Ca2+ regulates cardiomyocyte function. Cell. Calcium 44, 230–242 (2008).

    CAS  Article  PubMed  Google Scholar 

  41. 41.

    Monaco, S., Jahraus, B., Samstag, Y. & Bading, H. Nuclear calcium is required for human T cell activation. J. Cell. Biol. 215, 231–243 (2016).

    CAS  Article  PubMed  PubMed Central  Google Scholar 

  42. 42.

    Williams, D. A., Fogarty, K. E., Tsien, R. Y. & Fay, F. S. Calcium gradients in single smooth muscle cells revealed by the digital imaging microscope using Fura-2. Nature 312, 558–561 (1985).

    ADS  Article  Google Scholar 

  43. 43.

    Wang, Q., Shui, B., Kotlikoff, M. I. & Sondermann, H. Structural basis for calcium sensing by GCaMP2. Structure 16, 1817–1827 (2008).

    CAS  Article  PubMed  PubMed Central  Google Scholar 

  44. 44.

    Pang, Z. P., Xu, W., Cao, P. & Südhof, T. C. Calmodulin suppresses synaptotagmin-2 transcription in cortical neurons. J. Biol. Chem. 285, 33930–33939 (2010).

    CAS  Article  PubMed  PubMed Central  Google Scholar 

  45. 45.

    Dana, H. et al. Thy1-GCaMP6 transgenic mice for neuronal population imaging in vivo. PLoS ONE 9, e108697 (2014).

    ADS  Article  PubMed  PubMed Central  Google Scholar 

  46. 46.

    Madisen, L. et al. Transgenic mice for intersectional targeting of neural sensors and effectors with high specificity and performance. Neuron 85, 942–958 (2015).

    CAS  Article  PubMed  PubMed Central  Google Scholar 

  47. 47.

    Huber, D. et al. Multiple dynamic representations in the motor cortex during sensorimotor learning. Nature 484, 473–478 (2012).

    ADS  CAS  Article  PubMed  PubMed Central  Google Scholar 

  48. 48.

    Mank, M. et al. A FRET-based calcium biosensor with fast signal kinetics and high fluorescence change. Biophys. J. 90, 1790–1796 (2006).

    ADS  CAS  Article  PubMed  Google Scholar 

  49. 49.

    Palmer, A. E. et al. Ca2+ indicators based on computationally redesigned calmodulin-peptide pairs. Chem. Biol. 13, 521–530 (2006).

    CAS  Article  PubMed  Google Scholar 

  50. 50.

    Fosque, B. F. et al. Labeling of active neural circuits in vivo with designed calcium integrators. Science 347, 755–760 (2015).

    ADS  CAS  Article  PubMed  Google Scholar 

  51. 51.

    Nagai, T., Sawano, A., Park, E. S. & Miyawaki, A. Circularly permuted green fluorescent proteins engineered to sense Ca2+. Proc. Natl Acad. Sci. USA 98, 3197–3202 (2001).

    ADS  CAS  Article  PubMed  PubMed Central  Google Scholar 

  52. 52.

    Griesbeck, O., Baird, G. S., Campbell, R. E., Zacharias, D. A. & Tsien, R. Y. Reducing the environmental sensitivity of yellow fluorescent protein. Mech. Appl. J. Biol. Chem. 276, 29188–29194 (2001).

    CAS  Article  Google Scholar 

  53. 53.

    Yu, D., Baird, G. S., Tsien, R. Y. & Davis, R. L. Detection of calcium transients in Drosophila mushroom body neurons with camgaroo reporters. J. Neurosci. 23, 64–72 (2003).

    PubMed  Google Scholar 

  54. 54.

    Inoue, M. et al. Rational design of a high-affinity, fast, red calcium indicator R-CaMP2. Nat. Methods 12, 64–70 (2015).

    ADS  CAS  Article  PubMed  Google Scholar 

  55. 55.

    Yang, W., Lee, H. W., Hellinga, H. & Yang, J. J. Structural analysis, identification, and design of calcium-binding sites in proteins. Proteins 47, 344–356 (2002).

    CAS  Article  PubMed  Google Scholar 

  56. 56.

    Tsien, R. Y. The green fluorescent protein. Annu. Rev. Biochem. 67, 509–544 (1998).

    CAS  Article  PubMed  Google Scholar 

  57. 57.

    Fenno, L., Yizhar, O. & Deisseroth, K. The development and application of optogenetics. Annu. Rev. Neurosci. 34, 389–412 (2011).

    CAS  Article  PubMed  Google Scholar 

  58. 58.

    Jurado, L. A., Chockalingam, P. S. & Jarrett, H. W. Apocalmodulin. Physiol. Rev. 79, 661–682 (1999).

    CAS  Article  PubMed  Google Scholar 

  59. 59.

    Liang, H. et al. Unified mechanisms of Ca2+ regulation across the Ca2+ channel family. Neuron 39, 951–960 (2003).

    CAS  Article  PubMed  Google Scholar 

  60. 60.

    Zhang, S., Ehlers, M. D., Bernhardt, J. P., Su, C.-T. & Huganir, R. L. Calmodulin mediates calcium-dependent inactivation of N-methyl-D-aspartate receptors. Neuron 21, 443–453 (1998).

    CAS  Article  PubMed  Google Scholar 

  61. 61.

    Zheng, J. Molecular mechanism of TRP channels. Compr. Physiol. 3, 221–242 (2013).

    ADS  PubMed  PubMed Central  Google Scholar 

  62. 62.

    Isacoff, E. Y., Jan, L. Y. & Minor, D. L. Jr. Conduits of life’s spark: a perspective on ion channel research since the birth of neuron. Neuron 80, 658–674 (2013).

    CAS  Article  PubMed  Google Scholar 

  63. 63.

    Traynelis, S. F. et al. Glutamate receptor ion channels: structure, regulation, and function. Pharmacol. Rev. 62, 405–496 (2010).

    CAS  Article  PubMed  PubMed Central  Google Scholar 

  64. 64.

    Graef, I. A. et al. L-type calcium channels and GSK-3 regulate the activity of NF-ATc4 in hippocampal neurons. Nature 401, 703–708 (1999).

    ADS  CAS  Article  PubMed  Google Scholar 

  65. 65.

    Dolmetsch, R. E., Pajvani, U., Fife, K., Spotts, J. M. & Greenberg, M. E. Signaling to the nucleus by an L-type calcium channel-calmodulin complex through the MAP kinase pathway. Science 294, 333–339 (2001).

    ADS  CAS  Article  PubMed  Google Scholar 

  66. 66.

    Akerboom, J. et al. Crystal structures of the GCaMP calcium sensor reveal the mechanism of fluorescence signal change and aid rational design. J. Biol. Chem. 284, 6455–6464 (2009).

    CAS  Article  PubMed  PubMed Central  Google Scholar 

  67. 67.

    Liu, N., Liu, Y., Yang, Y. & Liu, X. Linker flexibility of IVS3-S4 loops modulates voltage-dependent activation of L-type Ca2+ channels. Channels 11, 34–45 (2016).

    Article  Google Scholar 

  68. 68.

    Gao, L., Blair, L. A., Salinas, G. D., Needleman, L. A. & Marshall, J. Insulin-like growth factor-1 modulation of CaV1.3 calcium channels depends on Ca2+ release from IP3-sensitive stores and calcium/calmodulin kinase II phosphorylation of the alpha1 subunit EF hand. J. Neurosci. 26, 6259–6268 (2006).

    CAS  Article  PubMed  Google Scholar 

  69. 69.

    Hall, D. D. et al. Competition between alpha-actinin and Ca(2)(+)-calmodulin controls surface retention of the L-type Ca(2)(+) channel Ca(V)1.2. Neuron 78, 483–497 (2013).

    CAS  Article  PubMed  PubMed Central  Google Scholar 

Download references

Acknowledgements

We thank all Liu-Lab (X-Lab) members for discussions and help, and particularly Dr. M. Liu for her pilot experiments on GCaMP effects on CaV1.3 gating. We acknowledge the researchers who shared constructs as indicated in the Methods section. We also thank Drs. K.X. Yuan, J. Yao and Y.C. Jia, and graduate students X.J. Piao and C.G. Chen all from Tsinghua University, for providing technical help. This work is supported by Natural Science Foundation of China (NSFC) grants 21778034, 31370822, 81171382, 81371604, 31571080 and 31522025 and Beijing Natural Science Foundation (BNSF) grant 7142089.

Author information

Affiliations

Authors

Contributions

Y.Y., Y.H., N.L., Y.L., and L.G. performed the experiments and analyses. Y.Y. and N.L. participated in manuscript preparations including text and figures. L.Z., S.S., and W.X. contributed to live tissue/animal experiments and analysis. X.L. conceived the project, designed the experiments and wrote the paper.

Corresponding author

Correspondence to Xiaodong Liu.

Ethics declarations

Competing interests

The authors declare no competing interests.

Additional information

Publisher's note: Springer Nature remains neutral with regard to jurisdictional claims in published maps and institutional affiliations.

Electronic supplementary material

Rights and permissions

Open Access This article is licensed under a Creative Commons Attribution 4.0 International License, which permits use, sharing, adaptation, distribution and reproduction in any medium or format, as long as you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons license, and indicate if changes were made. The images or other third party material in this article are included in the article’s Creative Commons license, unless indicated otherwise in a credit line to the material. If material is not included in the article’s Creative Commons license and your intended use is not permitted by statutory regulation or exceeds the permitted use, you will need to obtain permission directly from the copyright holder. To view a copy of this license, visit http://creativecommons.org/licenses/by/4.0/.

Reprints and Permissions

About this article

Verify currency and authenticity via CrossMark

Cite this article

Yang, Y., Liu, N., He, Y. et al. Improved calcium sensor GCaMP-X overcomes the calcium channel perturbations induced by the calmodulin in GCaMP. Nat Commun 9, 1504 (2018). https://doi.org/10.1038/s41467-018-03719-6

Download citation

Further reading

Comments

By submitting a comment you agree to abide by our Terms and Community Guidelines. If you find something abusive or that does not comply with our terms or guidelines please flag it as inappropriate.

Search

Quick links

Nature Briefing

Sign up for the Nature Briefing newsletter — what matters in science, free to your inbox daily.

Get the most important science stories of the day, free in your inbox. Sign up for Nature Briefing